DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and rump

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_649899.1 Gene:rump / 41138 FlyBaseID:FBgn0267790 Length:632 Species:Drosophila melanogaster


Alignment Length:231 Identity:74/231 - (32%)
Similarity:104/231 - (45%) Gaps:54/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 DADDAVKARD------GYDYDGYRLRVEFPRGGGPGSYRGG-NRNDRSRDGGGRMGGRGPPAKRS 113
            ||.::|::|:      |....|.|.......|.|.||..|| ...||||:             |.
  Fly     4 DASNSVESREKERDRRGRGARGSRFTDADGNGNGAGSQGGGVAARDRSRE-------------RR 55

  Fly   114 QYRVMVTGLPASGSWQDLKDHMRE-AGDVCFADTYKD------GSGVVEFLRHEDMKYAIKKLDD 171
            ..||.::.:|....||||||..|. .|.:.:...:.|      |.|:|||...|:::.|::|:  
  Fly    56 NCRVYISNIPYDYRWQDLKDLFRRIVGSIEYVQLFFDESGKARGCGIVEFKDPENVQKALEKM-- 118

  Fly   172 SRFRSHEGEVAYIRVREDSGD---------NDRGGGGGGSG------GGGGGSGGGGSRDYRDRS 221
            :|:..:..|:.   |:||.|:         .|.||||||.|      ||..|.||||.||:.| .
  Fly   119 NRYEVNGRELV---VKEDHGEQRDQYGRIVRDGGGGGGGGGGVQGGNGGNNGGGGGGGRDHMD-D 179

  Fly   222 RSRSFSSR--PRRRGTPTYSPVRRQSYSRSRSRSNY 255
            |.|.||.|  .|..|...:: :....|:.|   |||
  Fly   180 RDRGFSRRDDDRLSGRNNFN-MMSNDYNNS---SNY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 7/29 (24%)
RRM2_SRSF1_like 115..188 CDD:410013 23/79 (29%)
rumpNP_649899.1 PABP-1234 48..435 CDD:130689 61/187 (33%)
RRM1_hnRNPM_like 58..133 CDD:240831 23/79 (29%)
RRM2_hnRNPM_like 234..307 CDD:240832
RRM <543..>631 CDD:223796
RRM_SF 565..630 CDD:302621
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.