DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf6

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001001248.1 Gene:srsf6 / 407954 XenbaseID:XB-GENE-488901 Length:568 Species:Xenopus tropicalis


Alignment Length:274 Identity:112/274 - (40%)
Similarity:143/274 - (52%) Gaps:47/274 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|...:|.||||..|..:||:..|||||..|    ||||||:|||||||...:|.|..|.
 Frog     3 RVYIGRLGYHVREKDIQRFFGGYGKLLEVDLKNGYG----FVEFEDSRDADDAVYELNGKDLCGE 63

  Fly    73 RLRVEFPRGG-------GPGSYRGGNRNDRSRDGGGRMGGR---GPPAKRSQYRVMVTGLPASGS 127
            |:.||..||.       |.|| |.|.||.||        ||   |||. |:::|::|..|.:..|
 Frog    64 RVIVEHARGPRRDRDGYGYGS-RSGYRNQRS--------GRDKYGPPV-RTEFRLIVENLSSRCS 118

  Fly   128 WQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDS 190
            ||||||.||:||:|.:||.:|:  ..||:||..:.|||.|::|||.:......     ||:.|..
 Frog   119 WQDLKDFMRQAGEVTYADAHKERANEGVIEFRSYSDMKRAMEKLDGTEINGRR-----IRLVEGK 178

  Fly   191 GDNDRGGGGGGSGGGGGGSGGGGSRDYR-DRSRSRSFSSRPRRRG----------TPT-----YS 239
            ..:.|...|..|...........||..: ..|||||.|..|.::|          :||     .|
 Frog   179 ARHRRSYSGSRSRSRSRSRRRSRSRSRQPSHSRSRSRSHSPAKKGRSPAKKSRSHSPTKSSHSQS 243

  Fly   240 PVRRQSYSRSRSRS 253
            |.:.||.|||||||
 Frog   244 PGKSQSRSRSRSRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 37/71 (52%)
RRM2_SRSF1_like 115..188 CDD:410013 31/74 (42%)
srsf6NP_001001248.1 RRM1_SRSF6 3..72 CDD:241040 37/72 (51%)
RRM2_SRSF4_like 106..176 CDD:241044 31/74 (42%)
Rho 220..>403 CDD:333130 14/38 (37%)
RRM 325..>453 CDD:330708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.