DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf6a

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005161979.1 Gene:srsf6a / 406775 ZFINID:ZDB-GENE-040426-2824 Length:400 Species:Danio rerio


Alignment Length:303 Identity:114/303 - (37%)
Similarity:147/303 - (48%) Gaps:66/303 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|...:|.||||..|..:||:..|||||..|    ||||||.|||||||...:|.:..|.
Zfish     3 RVYIGRLSYHVREKDIQRFFSGYGKLLEVDLKNGYG----FVEFEDTRDADDAVYELNGKELCGE 63

  Fly    73 RLRVEFPR------------------GGGPGSYRGGNRNDRSRDGGGRMGGR------------- 106
            |:.||..|                  |||.|.|.||........|||  |||             
Zfish    64 RVMVEHARGPRRDRDSYGGGGGGGGGGGGGGGYYGGGGGGGGGGGGG--GGRSGYSSRSRTGRDK 126

  Fly   107 -GPPAKRSQYRVMVTGLPASGSWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKK 168
             |||. |::||::|..|.:..|||||||.||:||:|.:||.:|:  ..||:||..:.||:.|::|
Zfish   127 YGPPV-RTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERANEGVIEFRSYSDMRRALEK 190

  Fly   169 LDDS---------------RFRSHEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYR 218
            ||.:               |.||:.|..:..|.|..|  ..|......|...........||.:|
Zfish   191 LDGTDINGRKIRLVEDKPRRRRSYSGSRSRSRSRRRS--RSRSRRSSRSRSNSRSRSRSRSRRHR 253

  Fly   219 DRS----RSRSFSSRPRRRGTPTYSPVR---RQSYSRSRSRSN 254
            .||    ||||.|....|..:|: |..|   |:|:||||||::
Zfish   254 SRSRSGRRSRSKSGHKSRSKSPS-SKSRSRNRKSHSRSRSRTH 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 36/71 (51%)
RRM2_SRSF1_like 115..188 CDD:410013 34/89 (38%)
srsf6aXP_005161979.1 RRM <3..137 CDD:223796 55/140 (39%)
RRM_SF 3..72 CDD:302621 36/72 (50%)
RRM2_SRSF4_like 135..206 CDD:241044 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.