DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tia1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_012814227.2 Gene:tia1 / 394890 XenbaseID:XB-GENE-1002876 Length:389 Species:Xenopus tropicalis


Alignment Length:204 Identity:44/204 - (21%)
Similarity:74/204 - (36%) Gaps:57/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRNECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKA 63
            |::...::||:|.|:|.|.||:..|..||:::    ..|:...:...:.||.|.:..||::|:..
 Frog   102 SQDHFHVFVGDLSPEITTDDIKAAFAPFGRISDARVVKDMTTGKSKGYGFVSFFNKWDAENAIAQ 166

  Fly    64 RDGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYR------------ 116
            ..|....|.::|..:                         ..|.|||.:|.|.            
 Frog   167 MGGQWLGGRQIRTNW-------------------------ATRKPPAPKSTYESNTKQLTYEEVV 206

  Fly   117 --------VMVTGLPASGSWQDLKDHMREA----GDVCFADTYKD-GSGVVEFLRHEDMKYAIKK 168
                    .:..|...||..:.|   ||:.    |.:.....:.| |...|.|..||...:||..
 Frog   207 NQSSPSNCTVYCGGVTSGLTEQL---MRQTFSPFGQIMEVRVFPDKGYSFVRFSSHESAAHAIVS 268

  Fly   169 LDDSRFRSH 177
            ::.:....|
 Frog   269 VNGTTIEGH 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 22/80 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 17/88 (19%)
tia1XP_012814227.2 RRM1_TIA1 8..81 CDD:410027
RRM2_TIA1 104..181 CDD:410030 21/76 (28%)
RRM3_TIAR 214..286 CDD:241064 16/67 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.