DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tial1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_005156854.1 Gene:tial1 / 394107 ZFINID:ZDB-GENE-040426-1547 Length:399 Species:Danio rerio


Alignment Length:209 Identity:45/209 - (21%)
Similarity:75/209 - (35%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFED----------AR 55
            |...::||:|.|:|.|.||:..|..|||::    ..|:...:...:.||.|.:          .:
Zfish   113 NHFHVFVGDLSPEITTDDIRAAFAPFGKISDARVVKDMTTGKSKGYGFVSFYNKLVRLQYRNRVK 177

  Fly    56 DADDAVKARDGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRS------- 113
            ||::|:....|....|.::|..:                         ..|.|||.:|       
Zfish   178 DAENAIVHMGGQWLGGRQIRTNW-------------------------ATRKPPAPKSVQDNSAK 217

  Fly   114 QYR---VMVTGLP------ASGSWQDLKDH-MREA----GDVCFADTYKD-GSGVVEFLRHEDMK 163
            |.|   |:....|      ..|....|.:| ||:.    |.:.....:.: |...:.|..||...
Zfish   218 QLRFDEVVNQSSPQNCTVYCGGIQSGLTEHLMRQTFSPFGQIMEIRVFPEKGYSFIRFSSHESAA 282

  Fly   164 YAIKKLDDSRFRSH 177
            :||..::.:....|
Zfish   283 HAIVSVNGTTIEGH 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 23/88 (26%)
RRM2_SRSF1_like 115..188 CDD:410013 16/78 (21%)
tial1XP_005156854.1 RRM 7..295 CDD:223796 44/206 (21%)
RRM_SF 9..108 CDD:302621
RRM2_TIAR 114..203 CDD:241061 22/113 (19%)
RRM3_TIAR 233..305 CDD:241064 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.