DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and CG3335

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_648337.1 Gene:CG3335 / 39119 FlyBaseID:FBgn0036018 Length:918 Species:Drosophila melanogaster


Alignment Length:182 Identity:34/182 - (18%)
Similarity:74/182 - (40%) Gaps:29/182 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPP---------FAFVEFEDARDADDAVKAR 64
            :::.||......:.::..|...|.:..|::..||.|.         :.|::|:.:..|:.|:|..
  Fly   681 LFLRNLNFKTVQETVEKHFRHLGSIHTVEIAKRRDPENPREFKSLGYGFIQFKKSSVAEHALKNL 745

  Fly    65 DGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQ 129
            .....|           |.|...:..:|..:::|..|.........|::..:::|..:|....::
  Fly   746 QLTHID-----------GNPVELKRSDRVLKTQDNDGAQRRLASQKKQTGTKILVRNIPFQAQYR 799

  Fly   130 DLKDHMREAGDVCF------ADTYKD---GSGVVEFLRHEDMKYAIKKLDDS 172
            :::|..:..|::..      |.|.:|   |.|.|:::...:.|.|...|..|
  Fly   800 EVRDIFKAFGELRSLRIPKKATTGEDAHRGFGFVDYMSKAEAKRAFDALSAS 851

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 14/79 (18%)
RRM2_SRSF1_like 115..188 CDD:410013 14/67 (21%)
CG3335NP_648337.1 RRM1_RBM19 2..77 CDD:241008
RRM_SF 250..314 CDD:302621
RRM3_RBM19 362..440 CDD:241011
RRM4_RBM19 552..623 CDD:241013
RRM <638..845 CDD:223796 31/174 (18%)
RRM5_RBM19_like 679..760 CDD:240764 16/89 (18%)
RRM6_RBM19 785..864 CDD:241015 14/67 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.