DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tra2

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_476764.1 Gene:tra2 / 36619 FlyBaseID:FBgn0003742 Length:264 Species:Drosophila melanogaster


Alignment Length:100 Identity:31/100 - (31%)
Similarity:47/100 - (47%) Gaps:26/100 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IQDLFHKFGKV----TFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGYRLRVEF----- 78
            :::||:|:|.:    ..:|.:.:|...|.|:.||...||..|..:..|.:.||.|:||:|     
  Fly   113 VRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSITQR 177

  Fly    79 -------------PRGGGPGSY--RGGNR--NDRS 96
                         |||..|.|:  |.|.|  :|||
  Fly   178 AHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069 20/78 (26%)
RRM2_SRSF1_like 115..188 CDD:410013
tra2NP_476764.1 RRM_TRA2 96..175 CDD:409798 20/61 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.