DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Srsf4

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001102155.1 Gene:Srsf4 / 362612 RGDID:1561347 Length:488 Species:Rattus norvegicus


Alignment Length:278 Identity:110/278 - (39%)
Similarity:141/278 - (50%) Gaps:50/278 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|....|.:|::..|..:||:..|||||..|    ||||:|.|||||||...:|.|..|.
  Rat     3 RVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYG----FVEFDDLRDADDAVYELNGKDLCGE 63

  Fly    73 RLRVEFPRGGGP---GSYRGGNRNDRSRDG-GGRMGGR---GPPAKRSQYRVMVTGLPASGSWQD 130
            |:.||..|  ||   |||..|      |.| |.|..||   |||. |::||::|..|.:..||||
  Rat    64 RVIVEHAR--GPRRDGSYGSG------RSGYGYRRSGRDKYGPPT-RTEYRLIVENLSSRCSWQD 119

  Fly   131 LKDHMREAGDVCFADTYK--DGSGVVEFLRHEDMKYAIKKLDD---------------------- 171
            |||:||:||:|.:||.:|  ...||:||:.:.|||.|::|||.                      
  Rat   120 LKDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSRRRRS 184

  Fly   172 -SRFRSHEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGT 235
             ||.|||....:  |.|.......|.|....|..........||.. |.:||||| .||.|.:..
  Rat   185 YSRSRSHSRSRS--RSRHSRKSRSRSGSSKSSHSKSRSRSRSGSHS-RSKSRSRS-QSRSRSKKE 245

  Fly   236 PTYSPVRRQSYSRSRSRS 253
            .:.|| .:.:.|||||||
  Rat   246 KSRSP-SKDNKSRSRSRS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/71 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 36/97 (37%)
Srsf4NP_001102155.1 RRM1_SRSF4_like 3..72 CDD:240783 34/74 (46%)
RRM2_SRSF4_like 104..175 CDD:241044 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.