DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Srsf6

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001014207.2 Gene:Srsf6 / 362264 RGDID:1359241 Length:339 Species:Rattus norvegicus


Alignment Length:286 Identity:110/286 - (38%)
Similarity:144/286 - (50%) Gaps:57/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|..::|.||||..|..:|::..:||||..|    ||||||:|||||||...:..:..|.
  Rat     3 RVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYG----FVEFEDSRDADDAVYELNSKELCGE 63

  Fly    73 RLRVEFPRGGGPGSYRGGNRNDR------SRDGGG-----RMGGR---GPPAKRSQYRVMVTGLP 123
            |:.||..|         |.|.||      ||.|||     |..||   |||. |::||::|..|.
  Rat    64 RVIVEHAR---------G
PRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGPPV-RTEYRLIVENLS 118

  Fly   124 ASGSWQDLKDHMREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRV 186
            :..|||||||.||:||:|.:||.:|:  ..||:||..:.|||.|:.|||.:......     ||:
  Rat   119 SRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRALDKLDGTEINGRN-----IRL 178

  Fly   187 RED----------SGDNDRGGGGGGSGGGGGGSGGGGSRDY-RDRSRSRSFS---SRPRRRGTPT 237
            .||          ||...|......|......|....||.. :.||||||.|   ||.|.:|..:
  Rat   179 IEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKSRSRSRSRSKGRSRSRSKGRKS 243

  Fly   238 YSPVRRQ--------SYSRSRSRSNY 255
            .|..:.:        |:|||||:..|
  Rat   244 RSKSKSKPKSDRGSHSHSRSRSKDKY 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/71 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 32/74 (43%)
Srsf6NP_001014207.2 RRM_SF 1..72 CDD:418427 34/81 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..103 10/27 (37%)
RRM2_SRSF6 110..182 CDD:410159 33/76 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..339 30/94 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.