DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Snrnp70

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006229163.1 Gene:Snrnp70 / 361574 RGDID:1307120 Length:451 Species:Rattus norvegicus


Alignment Length:321 Identity:83/321 - (25%)
Similarity:106/321 - (33%) Gaps:109/321 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDL--KNRRGPP--FAFVEFEDARDADDAVKARDGYDY 69
            ::|..:..|.....::..|..:|.:..:.:  ..|.|.|  :||:|:|..||...|.|..||...
  Rat   105 LFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKI 169

  Fly    70 DGYRLRVEFPR------------GGG-PGSYRGG---NRNDRSRDGGGRMGGRGPPAKRSQYRVM 118
            ||.|:.|:..|            ||| .|:.|||   |.....||...|...|..|:.       
  Rat   170 DGRRVLVDVERGRTVKGW
RPRRLGGGLGGTRRGGADVNIRHSGRDDTSRYDERPGPSP------- 227

  Fly   119 VTGLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLD-DSRFRSHEGEVA 182
               ||.....:|.:...||      ....:|........|..|.:...:..| |.|.||      
  Rat   228 ---LPHRDRDRDRERERRE------RSRERDKERERRRSRSRDRRRRSRSRDKDERRRS------ 277

  Fly   183 YIRVREDSGDNDR-------------------------GGGGGGSGGGGGGSGGGG--------- 213
                ||.|.|.||                         ||||||.||||||.||||         
  Rat   278 ----RERSKDKDRDRKRRSSRSRERARRERERKEELRGGGGGGGGGGGGGGGGGGGDMAEPSEAG 338

  Fly   214 --------------------SRDYRDRSRSRSFSSRPRRRGTPTYSPVRRQSYSRSRSRSN 254
                                ....|||.|.|..|.|..|.        ||:...|.|.|.:
  Rat   339 DGAPDDGPPGELGPEGPDGPEEKGRDRDRERRRSHRSERE--------RRRDRDRDRDREH 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 21/74 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 13/73 (18%)
Snrnp70XP_006229163.1 U1snRNP70_N 2..93 CDD:289024
RRM 26..>182 CDD:223796 22/76 (29%)
RRM_snRNP70 102..187 CDD:240682 22/81 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.