DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Snrnp35

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001014149.1 Gene:Snrnp35 / 360803 RGDID:1310724 Length:244 Species:Rattus norvegicus


Alignment Length:237 Identity:47/237 - (19%)
Similarity:86/237 - (36%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVTFV----DLKNRRGPPFAFVEFEDARDADDAVKARDGYDY 69
            ::|..|....:.:.::::|.::|.:..:    ||.......:||:|:::.|....|.:..||...
  Rat    53 LFVARLNSQTKEEKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERALLKAYRDADGLVI 117

  Fly    70 DGYRLRVEF----------PR--GGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGL 122
            |.:.:.|::          ||  |||.|.        :...|..|.|||..|.::.....:|...
  Rat   118 DQHEIFVDYELERTLRGWIP
RRLGGGLGG--------KKESGQLRFGGRDRPFRKPINLPVVKNE 174

  Fly   123 PASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYI--- 184
            |.....::.::..|.          :|        ||.|.:...:..|..| ..|..:.|.:   
  Rat   175 PHREGKRERRERSRS----------RD--------RHWDPRPRERDHDRGR-EKHWQDRARVWPE 220

  Fly   185 ----RVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSR 222
                |.||...:..:                  :||.||||:
  Rat   221 NDWEREREFRDERAK------------------TRDKRDRSK 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 15/84 (18%)
RRM2_SRSF1_like 115..188 CDD:410013 12/79 (15%)
Snrnp35NP_001014149.1 RRM <41..>126 CDD:223796 15/72 (21%)
RRM_snRNP35 48..137 CDD:240683 15/83 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..244 25/142 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.