DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tia1l

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_956476.1 Gene:tia1l / 323447 ZFINID:ZDB-GENE-030131-2167 Length:342 Species:Danio rerio


Alignment Length:271 Identity:59/271 - (21%)
Similarity:100/271 - (36%) Gaps:66/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARD 65
            |...::||:|.|:|.|.|::..|..|||::    ..||...:...:.|:.|.:..||:.|::..:
Zfish    95 NHFHVFVGDLSPEISTDDVRAAFAPFGKISDARVVKDLATGKSKGYGFISFINKWDAESAIQQMN 159

  Fly    66 GYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQY-RVMVTGLPAS---- 125
            |....|.::|..:.. ..|.:.:..|              .|..:|...| .|:....|::    
Zfish   160 GQWLGGRQIRTNWAT-RKPSAPKSNN--------------EGASSKHLSYEEVLNQSSPSNCTVY 209

  Fly   126 --GSWQDLKDH-MREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEV-AYIRV 186
              |....|.|. ||:        |:.....::|.....:..|:.     .||.||||.. |.:.|
Zfish   210 CGGIASGLSDQLMRQ--------TFSPFGQIMEIRVFPEKGYSF-----VRFDSHEGAAHAIVSV 261

  Fly   187 REDSGDNDRGGGGGGSGGGGGGSGGGGSRDY--RDRSRSRSFSSRPR-RRGTPTYS--PVRR--Q 244
                              .|....|...:.|  ::.:..||....|. ::..|||:  |..:  |
Zfish   262 ------------------NGTCIEGHTVKCYWGKETADMRSMQQMPMPQQNKPTYAAQPYGQWGQ 308

  Fly   245 SYSRSRSRSNY 255
            ||...:....|
Zfish   309 SYGNGQQMGQY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 22/78 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 19/81 (23%)
tia1lNP_956476.1 ELAV_HUD_SF 7..272 CDD:273741 47/222 (21%)
RRM_SF 10..90 CDD:302621
RRM2_TIA1 96..175 CDD:241062 21/79 (27%)
RRM3_TIAR 206..278 CDD:241064 19/102 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.