DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Rbp1-like

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_001188585.1 Gene:Rbp1-like / 32293 FlyBaseID:FBgn0030479 Length:247 Species:Drosophila melanogaster


Alignment Length:235 Identity:69/235 - (29%)
Similarity:84/235 - (35%) Gaps:100/235 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKN---RRGPP-FAFVEFEDARDADDAVKARDGY 67
            |::|||||.......:|::.|.|:|     .|:|   .|.|| ||||||||.|||:||.:..||.
  Fly    11 CKVYVGNLGSSASKYEIENAFSKYG-----PLRNVWVARNPPGFAFVEFEDRRDAEDATRGLDGT 70

  Fly    68 DYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLK 132
            ...|.|:|||...|             |||:|.|..||.|                         
  Fly    71 RCCGTRIRVEMSSG-------------RSREGRGGGGGGG------------------------- 97

  Fly   133 DHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGG 197
                            .|.|                                    .||...|||
  Fly    98 ----------------GGGG------------------------------------GSGGGGRGG 110

  Fly   198 GGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPT 237
            |.|...||||.:|.||.| ||.:|.|.:.:|..|...|.|
  Fly   111 GSGARAGGGGRAGDGGGR-YRIKSSSSTTTSTTRTTTTTT 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 35/76 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 2/72 (3%)
Rbp1-likeNP_001188585.1 RRM <11..>81 CDD:223796 34/74 (46%)
RRM_SRSF3_like 12..81 CDD:240819 33/73 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452124
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.