DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Tia1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_006236890.1 Gene:Tia1 / 312510 RGDID:1305742 Length:387 Species:Rattus norvegicus


Alignment Length:204 Identity:43/204 - (21%)
Similarity:76/204 - (37%) Gaps:57/204 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SRNECRIYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKA 63
            |::...::||:|.|:|.|:||:..|..||:::    ..|:...:...:.||.|.:..||::|::.
  Rat   103 SQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYGFVSFFNKWDAENAIQQ 167

  Fly    64 RDGYDYDGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYR------------ 116
            ..|....|.::|..:                         ..|.|||.:|.|.            
  Rat   168 MGGQWLGGRQIRTNW-------------------------ATRKPPAPKSTYESNTKQLSYDEVV 207

  Fly   117 --------VMVTGLPASGSWQDLKDHMREA----GDVCFADTYKD-GSGVVEFLRHEDMKYAIKK 168
                    .:..|...||..:.|   ||:.    |.:.....:.| |...:.|..||...:||..
  Rat   208 SQSSPGNCTVYCGGVTSGLTEQL---MRQTFSPFGQIMEIRVFPDKGYSFIRFSSHESAAHAIVS 269

  Fly   169 LDDSRFRSH 177
            ::.:....|
  Rat   270 VNGTTIEGH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 22/80 (28%)
RRM2_SRSF1_like 115..188 CDD:410013 16/88 (18%)
Tia1XP_006236890.1 ELAV_HUD_SF 6..281 CDD:273741 43/204 (21%)
RRM_SF 8..82 CDD:302621
RRM2_TIA1 106..185 CDD:241062 21/103 (20%)
RRM3_TIAR 215..287 CDD:241064 15/67 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.