DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and Srsf5

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_038967784.1 Gene:Srsf5 / 29667 RGDID:3664 Length:270 Species:Rattus norvegicus


Alignment Length:252 Identity:99/252 - (39%)
Similarity:132/252 - (52%) Gaps:33/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG 71
            ||:::|.|.|..|.||::..|..:|::..:|||  ||  |.||||||.|||||||...||.:...
  Rat     4 CRVFIGRLNPAAREKDVERFFKGYGRIRDIDLK--RG--FGFVEFEDPRDADDAVYELDGKELCS 64

  Fly    72 YRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKDHMR 136
            .|:.:|..|....|....|..:||......|...|..|..|::.|::|..|.:..|||||||.||
  Rat    65 ERVTIEHARARSRGGRGRGRYSDRFSSRRPRNDRRNAPPVRTENRLIVENLSSRVSWQDLKDFMR 129

  Fly   137 EAGDVCFADTY--KDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGGGG 199
            :||:|.|||.:  |...|||||..:.|:|.||:||........:     |::.|.|..:.|    
  Rat   130 QAGEVTFADAHRPKLNEGVVEFASYGDLKNAIEKLSGKEINGRK-----IKLIEGSKRHSR---- 185

  Fly   200 GGSGGGGGGSGGGGSRDYRDRSRSRSFS---SRPRRRGTPTYSPVRRQSYSRSRSRS 253
                          ||. |.|||:||.|   ||.|.|.:.:||..|.:|.|||:|||
  Rat   186 --------------SRS-RSRSRTRSSSRSRSRSRSRRSKSYSRSRSRSRSRSKSRS 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/72 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 31/74 (42%)
Srsf5XP_038967784.1 RRM1_SRSF5 5..74 CDD:410008 32/72 (44%)
RRM2_SRSF5 99..179 CDD:410158 34/84 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.