DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and drr-2

DIOPT Version :10

Sequence 1:NP_652611.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_499818.1 Gene:drr-2 / 259546 WormBaseID:WBGene00011730 Length:207 Species:Caenorhabditis elegans


Alignment Length:51 Identity:10/51 - (19%)
Similarity:17/51 - (33%) Gaps:16/51 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PKWRLTPGALSINSETSNP----------------NVFVHNKRTNNIDVFE 135
            |...|..|..|..|...:|                :.|:|:.:...|:.|:
 Worm    36 PSTNLPEGPYSATSAVKDPSHLPMGHHICFSVPNFDSFLHSLKEKGIETFQ 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_652611.1 RRM_SF 3..80 CDD:473069
RRM2_SRSF1_like 115..188 CDD:410013 5/37 (14%)
drr-2NP_499818.1 RRM 9..89 CDD:440488 10/51 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.