DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srp2

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_594570.1 Gene:srp2 / 2542772 PomBaseID:SPAC16.02c Length:365 Species:Schizosaccharomyces pombe


Alignment Length:312 Identity:97/312 - (31%)
Similarity:132/312 - (42%) Gaps:80/312 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NECRIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDY 69
            :|.|::||.:||....:|:.|.|..:|::  :|.|...|  |.|||.||||||.|.|....|.::
pombe     2 SETRLFVGRIPPQATREDMMDFFKGYGQI--LDCKLMNG--FGFVEVEDARDARDIVNDFQGKEF 62

  Fly    70 DGYRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKDH 134
            .|.|:.||..||       ...|.:..|:..   ..:.|..:|:.:|::|..|....|||||||.
pombe    63 MGSRIVVEPARG-------ERRRRENFRESA---ASKYPRPRRTGFRLIVENLSEDVSWQDLKDV 117

  Fly   135 MREAGDVCFADTYKD--GSGVVEFLRHEDMKYAIKKLD-------------------------DS 172
            ||:||:..|.|.:::  |:|||||...|||:.|:..|:                         .|
pombe   118 MRKAGEPTFTDAHRENPGAGVVEFSTEEDMRNALTSLNGEVIKGQAVTLREDPDAANEPLPEVPS 182

  Fly   173 RFRSHEGEVAYIRVRED---SGDNDRGGGGGGSGGGGGGSGGG------------GSRD-YRDRS 221
            |||| ....|..|.|:|   .||..|.....|.......:..|            |.|| ||..|
pombe   183 RFRS-RSPPARRRYRDDYRRGGDYRRDAYRPGRDDERRYAPRGEYRRNNRDEYRRGGRDEYRRNS 246

  Fly   222 RS---------------------RSFSSRPRRRGTPTY-SPVRRQSYSRSRS 251
            ||                     |....|.|..|.|:: ...||.:||||.|
pombe   247 RSDYRRPHDDEYRRPRGDEYRPGRDEYRRSRDDGRPSHDDEYRRDAYSRSPS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 30/74 (41%)
RRM2_SRSF1_like 115..188 CDD:410013 34/99 (34%)
srp2NP_594570.1 RRM 2..278 CDD:223796 87/290 (30%)
RRM_SF 5..69 CDD:302621 27/67 (40%)
RRM2_SRSF4_like 98..169 CDD:241044 27/70 (39%)
DUF1777 231..>342 CDD:285811 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.