powered by:
Protein Alignment SF2 and rnp-9
DIOPT Version :9
Sequence 1: | NP_001247139.1 |
Gene: | SF2 / 53443 |
FlyBaseID: | FBgn0283477 |
Length: | 255 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001359585.1 |
Gene: | rnp-9 / 182350 |
WormBaseID: | WBGene00007396 |
Length: | 312 |
Species: | Caenorhabditis elegans |
Alignment Length: | 73 |
Identity: | 22/73 - (30%) |
Similarity: | 38/73 - (52%) |
Gaps: | 4/73 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IYVGNLPPDIRTKDIQDLFHKFGKVTFVDL-KNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
:||||:.......|::|||..:|.:..|.: |.:| :|||.:|....|..|:...:|.:..|.
Worm 191 VYVGNISQQTTDADLRDLFSTYGDIAEVRIFKTQR---YAFVRYEKKECATKAIMEMNGKEMAGN 252
Fly 73 RLRVEFPR 80
::|..:.|
Worm 253 QVRCSWGR 260
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0724 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.