DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and tiar-2

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_496718.1 Gene:tiar-2 / 174909 WormBaseID:WBGene00012904 Length:434 Species:Caenorhabditis elegans


Alignment Length:255 Identity:72/255 - (28%)
Similarity:116/255 - (45%) Gaps:38/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKDIQDLFHKFGKVT----FVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDY 69
            ::||:|..:|.:..:::.|.|||:|:    ..|....:|..:.||.:....||:.|:...:|...
 Worm   134 VFVGDLCSEIDSTKLREAFVKFGEVSEAKIIRDNNTNKGKGYGFVSYPRREDAERAIDEMNGAWL 198

  Fly    70 DGYRLRVEF-PRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQ--YRVMVTGLPAS------ 125
            ....:|..: .|.......|||:|.|| |.|||  |||.....:|:  |..:.....|.      
 Worm   199 GRRTIRTNWATRKPDEDGERGGDRGDR-RGGGG--GGRDRYHNQSEKTYDEIFNQAAADNTSVYV 260

  Fly   126 GSWQDL-KDHMREA----GDVCFADTYK-DGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYI 184
            |:..:| :|.:|.|    |.:....|:| .|...|:|...|....||.:::::.........::.
 Worm   261 GNIANLGEDEIRRAFDRFGPINEVRTFKIQGYAFVKFETKESAARAIVQMNNADIGGQIVRCSWG 325

  Fly   185 RVREDSGDNDRG-GGGGGSG---------GGGGGSGGGGSRDYRDRSRSRSFSSRPRRRG 234
            :..:....::|| |||||||         ||||||||.|:      |:..:|:.||...|
 Worm   326 KSGDSGKPSERGSGGGGGSGNYGYGYGNSGGGGGSGGPGN------SQFSNFNQRPPPSG 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 18/75 (24%)
RRM2_SRSF1_like 115..188 CDD:410013 16/84 (19%)
tiar-2NP_496718.1 RRM 36..321 CDD:223796 49/189 (26%)
RRM_SF 42..113 CDD:302621
RRM_SF 133..207 CDD:302621 18/72 (25%)
RRM3_TIA1_like 256..326 CDD:240800 14/69 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.