DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and rsp-1

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_496442.1 Gene:rsp-1 / 174748 WormBaseID:WBGene00004698 Length:312 Species:Caenorhabditis elegans


Alignment Length:273 Identity:101/273 - (36%)
Similarity:135/273 - (49%) Gaps:46/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |||:|.|...:..|||:..|..:|::..|.|||    .|.||||:|.|||:|||...:|.:..|.
 Worm     4 RIYIGRLTSRVSEKDIEHFFRGYGQIRDVLLKN----GFGFVEFDDKRDAEDAVHDLNGKELGGE 64

  Fly    73 RLRVEF--PRGGG------PGSYRGGNRNDRSRDGGGRMGG--------RGPPAKRSQY------ 115
            |:.:::  |||||      .|..|||.|......|||  ||        ||||.:.|:|      
 Worm    65 RVILDYSKPRGGGGDRGGFGGGGRGGARVSSYSGGGG--GGRDRFDRYDRGPPRRESRYGRPYST 127

  Fly   116 --RVMVTGLPASGSWQDLKDHMREAG-DVCFADTYK-DGSGVVEFLRHEDMKYAIKKLDDSRFRS 176
              ||:|..|.:..|||||||.:|..| :..:|:.:| ....::.|....|:|..|:|.|......
 Worm   128 RHRVVVENLSSRISWQDLKDQVRRQGVEPTYAEAHKRPNEALLCFATPSDLKRCIEKCDGMDLNG 192

  Fly   177 HEGEVAYIRVREDSGDNDRGGGGGGSGGGGGGSGGGGSRDYRDRSRSRSFS-SRPRRRGTPTYSP 240
            .:     |::.:||     ..|...|...........||| |.||||||.| |:.|.|..|..| 
 Worm   193 RK-----IKMIDDS-----QAGRSRSRSNSRSRSRSRSRD-RRRSRSRSSSRSKSRSRSPPKRS- 245

  Fly   241 VRRQSYSRSRSRS 253
             ||:|.|:|||||
 Worm   246 -RRESKSKSRSRS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 29/73 (40%)
RRM2_SRSF1_like 115..188 CDD:410013 23/82 (28%)
rsp-1NP_496442.1 RRM <3..180 CDD:223796 67/181 (37%)
RRM1_SRSF4_like 4..73 CDD:240783 29/72 (40%)
RRM2_SRSF4_like 129..200 CDD:241044 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1390
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.