DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and rsp-5

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_495307.3 Gene:rsp-5 / 174073 WormBaseID:WBGene00004702 Length:208 Species:Caenorhabditis elegans


Alignment Length:233 Identity:75/233 - (32%)
Similarity:102/233 - (43%) Gaps:33/233 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDG- 71
            |:|:|.:|.:.|.:|::.....:||:..:.:|.    .||||:|||:|||:||....||...:| 
 Worm     3 RLYLGKIPYNARERDVERFLKGYGKINNISMKY----GFAFVDFEDSRDAEDACHDLDGKTMEGS 63

  Fly    72 -YRLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVTGLPASGSWQDLKDHM 135
             .||.||..||...|:.|.|:|:.|.|....|...|.||.:||:.|             |.|...
 Worm    64 SMRLVVEMARGKPRGNDRHGSRSPRRRSRSPRRRSRTPPRRRSRSR-------------DRKRSR 115

  Fly   136 REAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSR--FRSHEGEVAYIRVREDSGDNDRGGG 198
            |...    ..:.:..|.|.|..|..:.:....|.|..|  .||.....|..|.|..||...:.||
 Worm   116 RSRS----RSSSRSRSPVRESRRRSESRSPSPKRDLKREASRSRSPLPAKDRSRTRSGSPPKNGG 176

  Fly   199 GGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTP 236
            ........|.|   .|||..:||.|||.|.     |:|
 Worm   177 DRKRSVSRGRS---HSRDGSNRSVSRSPSP-----GSP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 28/73 (38%)
RRM2_SRSF1_like 115..188 CDD:410013 15/74 (20%)
rsp-5NP_495307.3 RRM <3..>77 CDD:223796 30/77 (39%)
RRM_SF 3..74 CDD:302621 28/74 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.