Sequence 1: | NP_001247139.1 | Gene: | SF2 / 53443 | FlyBaseID: | FBgn0283477 | Length: | 255 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_851030.1 | Gene: | SNRNP35 / 11066 | HGNCID: | 30852 | Length: | 251 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 45/206 - (21%) |
---|---|---|---|
Similarity: | 77/206 - (37%) | Gaps: | 70/206 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 IYVGNLPPDIRTKD--IQDLFHKFGKVTFV----DLKNRRGPPFAFVEFEDARDADDAVKARDGY 67
Fly 68 DYDGYRLRVEF----------PR--GGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVT 120
Fly 121 GLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIR 185
Fly 186 VREDSGDNDRG 196 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SF2 | NP_001247139.1 | RRM_SF | 3..80 | CDD:418427 | 17/86 (20%) |
RRM2_SRSF1_like | 115..188 | CDD:410013 | 11/72 (15%) | ||
SNRNP35 | NP_851030.1 | RRM_snRNP35 | 53..142 | CDD:240683 | 17/85 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0724 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |