DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and SNRNP35

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:NP_851030.1 Gene:SNRNP35 / 11066 HGNCID:30852 Length:251 Species:Homo sapiens


Alignment Length:206 Identity:45/206 - (21%)
Similarity:77/206 - (37%) Gaps:70/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IYVGNLPPDIRTKD--IQDLFHKFGKVTFV----DLKNRRGPPFAFVEFEDARDADDAVKARDGY 67
            ::|..|  :::||:  ::::|.::|.:..:    ||.......:||:|:::.|....|.:..||.
Human    58 LFVARL--NLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYAFIEYKEERAVIKAYRDADGL 120

  Fly    68 DYDGYRLRVEF----------PR--GGGPGSYRGGNRNDRSRDGGGRMGGRGPPAKRSQYRVMVT 120
            ..|.:.:.|::          ||  |||.|.        :...|..|.|||..|.::.      .
Human   121 VIDQHEIFVDYELERTLKGWIP
RRLGGGLGG--------KKESGQLRFGGRDRPFRKP------I 171

  Fly   121 GLPASGSWQDLKDHMREAGDVCFADTYKDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIR 185
            .||                 |...|.|::|                |:....|.||.|   .:..
Human   172 NLP-----------------VVKNDLYREG----------------KRERRERSRSRE---RHWD 200

  Fly   186 VREDSGDNDRG 196
            .|....|:|||
Human   201 SRTRDRDHDRG 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 17/86 (20%)
RRM2_SRSF1_like 115..188 CDD:410013 11/72 (15%)
SNRNP35NP_851030.1 RRM_snRNP35 53..142 CDD:240683 17/85 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.