DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and hnrnpm

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_004911113.1 Gene:hnrnpm / 100489127 XenbaseID:XB-GENE-993962 Length:744 Species:Xenopus tropicalis


Alignment Length:313 Identity:75/313 - (23%)
Similarity:101/313 - (32%) Gaps:126/313 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLF-HKFGKVTFVDL------KNRRGPPFAFVEFEDARDADDAVKARD 65
            |.::.|:|.|::.:.::||. .|.|:||:|:|      |:|   ..|.|||:.......||:..:
 Frog    74 RAFISNIPFDVKWQALKDLVKEKVGEVTYVELLMDDEGKSR---GCAAVEFKLEDSMKKAVQVLN 135

  Fly    66 GYDYDGYRLRV-EFPRG----------------------------------------GGPGSYRG 89
            .:..:|..|:| |.|.|                                        ||||....
 Frog   136 KHVLNGRPLKVREDPDGERSRRAAHSVFGPGPMGMGGPGPMGMGGPGPMGMPGPMGMGGPGPIGL 200

  Fly    90 GNRNDRSRDGGGRMGGRGPP-----------------AKRSQYRVMVTGLPASGSWQDLKDHMRE 137
            |........|.|.:||..||                 |.|....|.|..|..|..|:.||:....
 Frog   201 GGPGPLGMGGPGPVGGNIPPSLLNNPNIPREVIHALQAGRLGSTVFVANLDYSVGWKKLKEVFGI 265

  Fly   138 AGDVCFADTYKD------GSGVVEFLRHEDMKYAIK--------------KLDDSRFRSHEGEVA 182
            ||.|..||..:|      |.|.|.:.:..:...||.              |:||...        
 Frog   266 AGTVVRADVLEDKDGKSRGIGTVTYEQPIEAVQAISMFNGQPLFDRPMMVKMDDKSM-------- 322

  Fly   183 YIRVREDSGD---NDR--------GGGGGGSGGGG-------------GGSGG 211
                  ..||   .||        ||.|.|.|.||             ||.||
 Frog   323 ------PKGDLFPADRPPQLPRGLGGIGMGLGPGGQPIDANHLRGSTMGGPGG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 24/79 (30%)
RRM2_SRSF1_like 115..188 CDD:410013 21/92 (23%)
hnrnpmXP_004911113.1 HnRNP_M 48..72 CDD:371586
RRM1_hnRNPM 74..149 CDD:241101 23/77 (30%)
PABP-1234 76..>388 CDD:130689 74/311 (24%)
RRM2_hnRNPM_like 245..318 CDD:240832 19/72 (26%)
RRM3_hnRNPM 668..744 CDD:241105
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.