DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SF2 and srsf4

DIOPT Version :9

Sequence 1:NP_001247139.1 Gene:SF2 / 53443 FlyBaseID:FBgn0283477 Length:255 Species:Drosophila melanogaster
Sequence 2:XP_004911639.2 Gene:srsf4 / 100038227 XenbaseID:XB-GENE-493077 Length:741 Species:Xenopus tropicalis


Alignment Length:250 Identity:97/250 - (38%)
Similarity:127/250 - (50%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RIYVGNLPPDIRTKDIQDLFHKFGKVTFVDLKNRRGPPFAFVEFEDARDADDAVKARDGYDYDGY 72
            |:|:|.|....|.:|::..|..|||:..|||||..|    ||||||:|||:|||...:|.:..|.
 Frog     8 RVYIGRLSHRARERDVERFFKGFGKIVEVDLKNGYG----FVEFEDSRDAEDAVYEMNGRELCGE 68

  Fly    73 RLRVEFPRGGGPGSYRGGNRNDRSRDGGGRMGGR---GPPAKRSQYRVMVTGLPASGSWQDLKDH 134
            |:.||..|         ..|.|.....|.|.||.   |||. |:.||:.|..|.:..|||||||.
 Frog    69 RVIVEHAR---------A
PRRDIRSGYGYRKGGSDKYGPPV-RTMYRLRVENLSSRCSWQDLKDF 123

  Fly   135 MREAGDVCFADTY--KDGSGVVEFLRHEDMKYAIKKLDDSRFRSHEGEVAYIRVREDSGDNDRGG 197
            ||:||:|.:||.:  :...||:||..:.||:.|::|||.|.....:     |::.||.. ..|..
 Frog   124 MRQAGEVTYADAHQRRQNEGVIEFRSYSDMRRALEKLDGSEINGRK-----IQLVEDRA-GSRNK 182

  Fly   198 GGGGSGGGGGGSGGGGSRDYRDRSRSRSFSSRPRRRGTPTYSPVRRQSYSRSRSR 252
            |..........|....|...|.||||||.|...:|..:.:.|..||.|.|.||.|
 Frog   183 GSSSRSRSRSRSRRSRSSHSRSRSRSRSHSRSRQRERSRSRSKERRSSRSHSRKR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SF2NP_001247139.1 RRM_SF 3..80 CDD:418427 33/71 (46%)
RRM2_SRSF1_like 115..188 CDD:410013 30/74 (41%)
srsf4XP_004911639.2 RRM_SF 6..77 CDD:418427 34/81 (42%)
RRM_SF 104..176 CDD:418427 31/76 (41%)
ser_rich_anae_1 <249..>456 CDD:411418
PRK12678 352..>573 CDD:237171
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000217
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.