DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spt5 and AT4G08360

DIOPT Version :9

Sequence 1:NP_652610.1 Gene:Spt5 / 53442 FlyBaseID:FBgn0040273 Length:1078 Species:Drosophila melanogaster
Sequence 2:NP_192576.1 Gene:AT4G08360 / 826392 AraportID:AT4G08360 Length:141 Species:Arabidopsis thaliana


Alignment Length:113 Identity:31/113 - (27%)
Similarity:53/113 - (46%) Gaps:15/113 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   971 DWCTTDIEVR------IHTHDDTDLVGQTGIIRTVSNGVCSVFLRQ--EDRSVSIVSEHLAPVLP 1027
            ::...|:|||      :..|:     .:.|:||.||:|:|.|.|..  |..::.:.|..|..|.|
plant    30 EYSDEDVEVRFMPDILVTVHN-----SEVGVIRDVSDGMCKVSLGSGGEGDTIMVPSSELEIVRP 89

  Fly  1028 CNGDEFKIIYGDDRESVGRVLSKDGDVFVCRI--NEEIKLLPINFLCK 1073
            ...|..||:.|.......:::..||...:.:|  |.::|:|.:..|.|
plant    90 RKSDHVKILGGSYLGLTCKLIGIDGLDAIVKIDGNLDVKILDLALLAK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spt5NP_652610.1 Spt5_N <136..208 CDD:288770
nusG 212..352 CDD:181467
NGN_Euk 215..302 CDD:193577
KOW_Spt5_1 313..350 CDD:240505
KOW_Spt5_2 461..511 CDD:240506
KOW_Spt5_3 512..562 CDD:240507
KOW_Spt5_4 638..680 CDD:240508
KOW_Spt5_5 737..788 CDD:240509
CTD 812..908 CDD:215026
CTD 812..870 CDD:289577
KOW_Spt5_6 1020..1075 CDD:240510 15/56 (27%)
AT4G08360NP_192576.1 KOW_Spt5_6 82..139 CDD:240510 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D828863at2759
OrthoFinder 1 1.000 - - FOG0003457
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.