DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pont and RUVBL2

DIOPT Version :9

Sequence 1:NP_652608.1 Gene:pont / 53439 FlyBaseID:FBgn0040078 Length:456 Species:Drosophila melanogaster
Sequence 2:NP_006657.1 Gene:RUVBL2 / 10856 HGNCID:10475 Length:463 Species:Homo sapiens


Alignment Length:456 Identity:203/456 - (44%)
Similarity:307/456 - (67%) Gaps:15/456 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KIEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKKMAGRAL 66
            |:.|::...|.:||.||||::|||||:......::.|:|||.|||.|||:|:::|:..|:||||:
Human     9 KVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAV 73

  Fly    67 LLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLMENFRRSIGLRIRETKEVY 131
            |:||.|||||||||:.:||.||...||..:.|||:||.|:.|||.|.:.||||||:||:|..|:.
Human    74 LIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEII 138

  Fly   132 EGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDPSIFDALQKEKVEVGDVIYIEAN 196
            ||||.|   ::.:.|..|.|..:..:.  |||.:......|...:.::|.|:||:.||||.|:..
Human   139 EGEVVE---IQIDRPATGTGSKVGKLT--LKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKA 198

  Fly   197 SGAVKRQGRSDTFATEFDL--ETEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDVLSM 259
            :|.:.:.|||.|.|.::|.  ...::|..|.|::.|:|||:..|:||::||.|:|.||       
Human   199 TGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG------- 256

  Fly   260 MGQLMKPKKTEITDKLRMEINKVVNKYIDQGIAELVPGVLFIDEIHMLDLETFTYLHKSLESPIA 324
            ...|......||..::|.:||..|.::.::|.||::||||||||:||||:|:|::|:::|||.:|
Human   257 FLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMA 321

  Fly   325 PIVIFATNRGRCVIRGTTDIVSPHGIPLDLLDRLLIIRTLLYSTADMEQIIKLRAQTEGLQLEEN 389
            |::|.|||||...||||: ..||||||:||||||||:.|..||..|.:||:::|.:.|.:::.|:
Human   322 PVLIMATNRGITRIRGTS-YQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSED 385

  Fly   390 AFTRLSEIGTSSTLRYAVQLLTPAHQMCKVNGRNQISKDDIEDVHSLFLDAKRSSKHLSEKNNKF 454
            |:|.|:.||..::||||:||:|.|..:|:.....::..|||:.|:|||||..||::::.|..:.|
Human   386 AYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAF 450

  Fly   455 M 455
            :
Human   451 L 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pontNP_652608.1 TIP49 14..413 CDD:283678 185/400 (46%)
P-loop_NTPase 40..>80 CDD:304359 26/39 (67%)
P-loop_NTPase 66..>110 CDD:304359 25/43 (58%)
RUVBL2NP_006657.1 TIP49 15..451 CDD:224145 200/448 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1224
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D273414at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.