DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RecQ4 and RecQ5

DIOPT Version :9

Sequence 1:NP_652607.1 Gene:RecQ4 / 53438 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:NP_729983.1 Gene:RecQ5 / 39594 FlyBaseID:FBgn0027375 Length:1058 Species:Drosophila melanogaster


Alignment Length:534 Identity:158/534 - (29%)
Similarity:241/534 - (45%) Gaps:110/534 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   859 VLEALHM-FGHTNFRKG-QDRAIMRTLSGLSSL-VTLSTGSGKSLCYQLPAYLYSRKVGAITLVI 920
            |.|||.. |||:.|:.. |::|:...:.....: |::.||||||||:|||..:...:   ||:|.
  Fly     7 VHEALKKHFGHSKFKSDLQEKAVKCAVKKKQDVYVSMPTGSGKSLCFQLPGLMSENQ---ITIVF 68

  Fly   921 SPLVSLMEDQVTGVPHFLR----AHCLHTNQTAPQR----MKIQQMIANGEIDILLVSPEAVVAG 977
            |||::|::||   :.|..:    |..|::..:..:|    |.::.:..|  :..|.::||     
  Fly    69 SPLLALIKDQ---IDHLTKLKVPADSLNSKMSTKERDRVIMDLKAVRTN--LKFLYITPE----- 123

  Fly   978 ERATGFGAILRQL----PPIAFACIDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATA 1038
            :.||.|...|.|.    ..:|:..:|||||||||.|:|||.||.:.: ||........|.|||||
  Fly   124 QAATKFFQDLLQTLHKHNKLAYFAVDEAHCVSQWGHDFRPDYLKLGE-LRSKYSDVIWLALTATA 187

  Fly  1039 TLPTRVSIINHLGISDG---------ERGIISDIPLPDNLVLSVSKDENR--DAALLQLLNSERF 1092
            :...:..|...|.:...         .:.:..||...:    |:..|...  |.|...|.|.:.|
  Fly   188 SREVKEDIYKQLRLHQPVAQFSTPSFRKNLFYDIVYKN----SIEDDFQHLADFARHCLGNPKEF 248

  Fly  1093 ----EPCQSI-IIYCTRRDECERIAGFIRTCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRR 1152
                :|.:.. |:||..||:.||:|..:              ||:    ...|..||||:....|
  Fly   249 KDTPKPQRGCGIVYCRTRDQVERMAIGV--------------TKQ----GIGAVAYHAGLKTGER 295

  Fly  1153 RTVQKAFMSNELRIVVATIAFGMGINKPDIRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFL 1217
            ..||:|:|..:..|:.||.:||||::||.:|.|||:::|:|..:|.||.||||||||.|:|.|:.
  Fly   296 TEVQEAWMRGDQPIICATNSFGMGVDKPSVRFVIHWDVPQNVAAYYQESGRAGRDGLQSYCRLYY 360

  Fly  1218 DAKGGDQSELRRHVYSNSIDRHVIR-------------KLLQKIFVPCSCDKEASKRTALPIPLE 1269
               |.:.....|.:..|  |.|..|             |..:||       .|..:||.....|.
  Fly   361 ---GREDVRSIRFLLQN--DAHRARGRGDKELLTERAIKQFEKI-------TEFCERTTCRHKLF 413

  Fly  1270 GD--GPRVHMCPGHEIGFSVEKTVEMLDIPAENISTLLCYMELDPRWCISVLSSAYVMAK---VI 1329
            .|  |.....|.|.         .::...|.:....|    |:..|.|:.....:::..:   .:
  Fly   414 SDFFGDPTPDCSGQ---------CDVCKRPKKAEKAL----EIFHRLCMDDAFKSHISLQDCADL 465

  Fly  1330 SYGGPKYLKHAAKE 1343
            ..||...:|.||:|
  Fly   466 YEGGRPGIKRAAQE 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQL4_SLD2_NTD 9..55 CDD:421279
RecQ 864..>1218 CDD:223588 126/384 (33%)
RecQ5NP_729983.1 RecQ 6..>442 CDD:223588 149/495 (30%)
DEAD 37..193 CDD:278688 59/169 (35%)
HELICc <257..359 CDD:238034 48/119 (40%)
RecQ_Zn_bind 364..431 CDD:292742 16/84 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0514
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13710
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.