DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RecQ4 and Recql

DIOPT Version :9

Sequence 1:NP_652607.1 Gene:RecQ4 / 53438 FlyBaseID:FBgn0040290 Length:1579 Species:Drosophila melanogaster
Sequence 2:XP_006237679.1 Gene:Recql / 312824 RGDID:1311071 Length:645 Species:Rattus norvegicus


Alignment Length:474 Identity:141/474 - (29%)
Similarity:217/474 - (45%) Gaps:110/474 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   841 KPLYDLLPDGSVQ-----DTTP------------EVLEALH-MFGHTNFRKGQDRAIMRTLSGLS 887
            |.:...|.|.:.:     ||:|            :|...|. :|....||..|...:..|::...
  Rat    44 KRIKQCLEDSAAEASGDCDTSPAAWSKEDFPWSGKVKHVLRDVFKLQKFRPLQLETVNATMARKD 108

  Fly   888 SLVTLSTGSGKSLCYQLPAYLYSRKVGAITLVISPLVSLMEDQV-----TGVPHFL------RAH 941
            ..:.:.||.||||||||||....    ..||||.||:||||||:     .|:...:      :.|
  Rat   109 IFLVMPTGGGKSLCYQLPALCSD----GFTLVICPLISLMEDQLMVLQQLGISATMLNSSSSKEH 169

  Fly   942 --CLHTNQTAPQRMKIQQMIANGEIDILLVSPEAVVAG-------ERATGFGAILRQLPPIAFAC 997
              |:||          :.|..|..:.::.|:||.:...       |:|...|    :|..:|   
  Rat   170 VKCVHT----------EMMNKNSHLKLIYVTPEKIAKSKMFMSRLEKAYEAG----RLTGVA--- 217

  Fly   998 IDEAHCVSQWSHNFRPSYLMICKVLRKNLGVRTVLGLTATATLPTRVSIINHLGISDGERGIISD 1062
            :||.||.|||.|:|||.|..: .:|::.....:::|||||||        ||: :.|.::.:..:
  Rat   218 VDEVHCCSQWGHDFRPDYKAL-GILKRQFPNISLIGLTATAT--------NHV-LKDAQKILCVE 272

  Fly  1063 IPLP-------DNLVLSV----SKDENRDAALLQLLNSERFEPCQSIIIYCTRRDECERIAGFIR 1116
            ..|.       .||...|    |..|:....:..|:|. |::. :|.||||..:.:.|::     
  Rat   273 KCLTFTASFNRPNLYYEVRQKPSSAEDFIENIANLING-RYKG-KSGIIYCFSQKDSEQV----- 330

  Fly  1117 TCVQDRREPTQDQTKKRKRVNWQAEPYHAGMPASRRRTVQKAFMSNELRIVVATIAFGMGINKPD 1181
                         |...:::..:|..|||.|....|..|...:.:|||::||||:||||||:|||
  Rat   331 -------------TISLQKLGVRAGTYHANMEPEDRTKVHTQWSANELQVVVATVAFGMGIDKPD 382

  Fly  1182 IRAVIHYNMPRNFESYVQEIGRAGRDGLPSHCHLFLDAKGGDQSELRRHVYSNSIDRHVIRKLLQ 1246
            :|.|||::|.::.|:|.||.||||||...:.|.|:...  ||...:...|...::.:       |
  Rat   383 VRFVIHHSMSKSMENYYQESGRAGRDDWRADCILYYGF--GDIFRISSMVVMENVGQ-------Q 438

  Fly  1247 KIFVPCS-CDKEASKRTAL 1264
            |::...| |...:..|.||
  Rat   439 KLYEMVSYCQNISKCRRAL 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RecQ4NP_652607.1 RecQL4_SLD2_NTD 9..55 CDD:421279
RecQ 864..>1218 CDD:223588 123/385 (32%)
RecqlXP_006237679.1 recQ_fam 82..543 CDD:129701 134/436 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0514
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D445763at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.