DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and STS

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001307679.1 Gene:STS / 412 HGNCID:11425 Length:590 Species:Homo sapiens


Alignment Length:506 Identity:122/506 - (24%)
Similarity:187/506 - (36%) Gaps:166/506 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MRHSSLRLIIGGL---ILLLFVLNVFSKEQGSHSHKRSHSAKRFSRDSNSARERRPNIILILTDD 63
            |....|:|.|..:   .||||.|          ....||:|.            ||||||::.||
Human     1 MAQDRLQLFIAKMKIPFLLLFFL----------WEAESHAAS------------RPNIILVMADD 43

  Fly    64 QDVE----LGSLNFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTGMY-VHNHM-------- 115
            ..:.    .|:.......:..|..||.:.......:|:|.|:|::.:||.| |.:.|        
Human    44 LGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLAASPLCTPSRAAFMTGRYPVRSGMASWSRTGV 108

  Fly   116 -VFTNNDNCSSPQWQATHETRSYATYLSNAGYRTGYFGKYLNKYNGSYIPPGWREWG-GLIMNSK 178
             :||     :|.....|.|. ::|..|.:.||.|...||                |. |:..:||
Human   109 FLFT-----ASSGGLPTDEI-TFAKLLKDQGYSTALIGK----------------WHLGMSCHSK 151

  Fly   179 YYNYSINLNGQKIKHGFDYAKDYYPDLIANDSIAFLRSSKQQNQRKP------------------ 225
                 .:.....:.|||:|   :|...:.|     ||..      ||                  
Human   152 -----TDFCHHPLHHGFNY---FYGISLTN-----LRDC------KPGEGSVFTTGFKRLVFLPL 197

  Fly   226 -----VLLTMS-------FPAPHGPEDS----APQYSHLFFNVTTHHTP---------------- 258
                 .|||::       ...|.|...|    |.....||.....:..|                
Human   198 QIVGVTLLTLAALNCLGLLHVPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPM 262

  Fly   259 SYDHAPN----PDKQWILRVTEP-----MQPVHKRFTNLLMTKRL----------QTLQSVDVAV 304
            |||:...    ...|:|.|.||.     :..:|.. |.|..:|..          ..::.:|.:|
Human   263 SYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVH-TALFSSKDFAGKSQHGVYGDAVEEMDWSV 326

  Fly   305 ERVYNELKELGELDNTYIVYTSDHGYHL-----------GQFGLIK-GKSFPFEFDVRVPFLIRG 357
            .::.|.|.||...::|.|.:|||.|.|:           |..|:.| ||:..:|..:|||.::|.
Human   327 GQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRW 391

  Fly   358 PG-IQASKVVNEIVLNVDLAPTFLDMGGVPTPQH--MDGRSILPLLLSRNR 405
            |. |||.:.::|...|:|:.||...:.|.|.|:.  :|||.::|||..:::
Human   392 PRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 107/445 (24%)
G6S 53..408 CDD:293766 110/452 (24%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
STSNP_001307679.1 AslA 30..555 CDD:225661 111/467 (24%)
ES 33..557 CDD:293778 110/452 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157212
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.