DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and Arse

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001041350.1 Gene:Arse / 310326 RGDID:1304917 Length:611 Species:Rattus norvegicus


Alignment Length:455 Identity:93/455 - (20%)
Similarity:160/455 - (35%) Gaps:152/455 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPNIILILTDDQDV-ELGSL-NFMPRTLRL--LRDGGAEFRHAYTTTPMCCPARSSLLTGMY-VH 112
            |||.::|:.||..: :||.. |...||..:  |.:.|...........:|.|:|::.|||.| :.
  Rat    34 RPNFLIIMADDLGIGDLGCYGNTSIRTPNIDRLAEDGVRLTQYLAAESVCTPSRAAFLTGRYPIR 98

  Fly   113 NHMVFTNNDNCSSPQWQA-----THETRSYATYLSNAGYRTGYFGKY----------------LN 156
            :.|  |:.:.....||.|     ..:..::|..|...||.||..||:                ||
  Rat    99 SGM--TSGNGHRVLQWAAGAGGLPPKEITFARILQGQGYVTGLVGKWHLGLSCRTVSDLCHHPLN 161

  Fly   157 -------------------------------KYNGS---------------------YIPPGWRE 169
                                           :..|:                     ..|..|..
  Rat   162 HGFHHFLGLPLGMMGDCAGAEPSEKRAGLERRLRGAGRALAAVAVAIAALAWGRGRGLAPACWAP 226

  Fly   170 W--------------GGLIMNSKYYNYSINLNGQKIKHGFDYAKDYYPDLIANDSIAFLRSSKQQ 220
            |              |..::......|...|.............|:...|:..::..|||    :
  Rat   227 WAAIALGAVAAIFEAGSYVVGGAVARYDCFLMRNATVTQQPLQLDHVTPLLLREAKDFLR----R 287

  Fly   221 NQRKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQPVHKRF 285
            ::..|.||.:|....|.|..::|::..                               :..|.|:
  Rat   288 HRHAPFLLFLSLLHTHTPLVTSPEFRG-------------------------------RSAHGRY 321

  Fly   286 TNLLMTKRLQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHL----------GQFGLIK- 339
            .:        .::.:|..|.::...|:..|..|:|.:.:|||:|..|          |..|:.: 
  Rat   322 GD--------NVEEMDWVVGQILEVLEHEGLTDSTLVHFTSDNGAWLEAQAGGEQLGGSNGVFRG 378

  Fly   340 GKSF-PFEFDVRVPFLIRGPGI-QASKVVNEIVLNVDLAPTFLDMGG--VPTPQHMDGRSILPLL 400
            ||.. .:|..:|||.:.|.||: ...:|:::.|..:|:.||.:.:||  :|:.:.:|||.:||||
  Rat   379 GKGMGGWEGGIRVPGVFRWPGVLPRGRVLDQPVSLMDVFPTVVRLGGGVLPSDREIDGRDLLPLL 443

  Fly   401  400
              Rat   444  443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 89/451 (20%)
G6S 53..408 CDD:293766 93/455 (20%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
ArseNP_001041350.1 AslA 31..541 CDD:225661 93/455 (20%)
ALP_like 34..531 CDD:304875 93/455 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351120
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273622at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.