DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and Arsi

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_001041346.1 Gene:Arsi / 307404 RGDID:1310242 Length:573 Species:Rattus norvegicus


Alignment Length:393 Identity:102/393 - (25%)
Similarity:158/393 - (40%) Gaps:83/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NSARERRPNIILILTDDQ---DVELGSLNFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTG 108
            ::|..:.|:||.||||||   ||.....:....||..|...|.:..: |...|:|.|:||.||||
  Rat    40 SAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRLAAEGVKLEN-YYIQPICTPSRSQLLTG 103

  Fly   109 MY-VH----NHMVFTNNDNCSSPQWQATHETRSYATYLSNAGYRTGYFGK-YLNKYNGSYIPP-- 165
            .| :|    :.::.....|| .|..|.|...:     |..|||.|...|| :|..|....:|.  
  Rat   104 RYQIHTGLQHSIIRPRQPNC-LPLDQVTLPQK-----LQEAGYSTHMVGKWHLGFYRKECLPTRR 162

  Fly   166 GWREW-GGLIMNSKYYNYSINLNGQKIKHGFD----------YAKDYYPDLIANDSIAFLRSSKQ 219
            |:..: |.|..|..||.|. |.:|..: .|||          .:..|...|.|..:...|.|...
  Rat   163 GFDTFLGSLTGNVDYYTYD-NCDGPGV-CGFDLHEGESVAWGLSGQYSTMLYAQRASHILASHSP 225

  Fly   220 QNQRKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQPVHKR 284
            |   ||:.|.::|.|.|.|..|..:|.:.:                                 :.
  Rat   226 Q---KPLFLYVAFQAVHTPLQSPREYLYRY---------------------------------RT 254

  Fly   285 FTNLLMTKRLQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHLGQFGLIKGKSFP----- 344
            ..|:...|....:..:|.||..:...||..|..:|:.|:::||:|   || ....|.::|     
  Rat   255 MGNVARRKYAAMVTCMDEAVRNITWALKRYGFYNNSVIIFSSDNG---GQ-TFSGGSNWPLRGRK 315

  Fly   345 ---FEFDVRVPFLIRGPGIQASKVVNEIVLNV-DLAPTFLDMGGVPT--PQHMDGRSILPLLLSR 403
               :|..||....:..|.::..:..:..:::: |..||.:.:.|..|  ...:||..:.| .:|.
  Rat   316 GTYWEGGVRGLGFVHSPLLKKKRRTSRALVHITDWYPTLVGLAGGTTSAADGLDGYDVWP-AISE 379

  Fly   404 NRA 406
            .||
  Rat   380 GRA 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 97/379 (26%)
G6S 53..408 CDD:293766 101/387 (26%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
ArsiNP_001041346.1 4-S 48..478 CDD:293753 100/385 (26%)
AslA 49..485 CDD:225661 100/384 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 506..550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351114
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.