DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and GNS

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_002067.1 Gene:GNS / 2799 HGNCID:4422 Length:552 Species:Homo sapiens


Alignment Length:427 Identity:167/427 - (39%)
Similarity:234/427 - (54%) Gaps:47/427 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LRLIIGGLILLLFVLNVFSKEQGSHSHKRSHSAKRFSRDSNSARERRPNIILILTDDQDVELGSL 71
            |.|::||      .|.||....|:                     ||||::|:||||||..||.:
Human    27 LLLVLGG------CLGVFGVAAGT---------------------RRPNVVLLLTDDQDEVLGGM 64

  Fly    72 NFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTGMYVHNHMVFTN--NDNCSSPQWQATHET 134
            ..:.:|..|:.:.|..|..||..:.:|||:|:|:|||.|.|||.|..|  ..||||..||...|.
Human    65 TPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEP 129

  Fly   135 RSYATYL-SNAGYRTGYFGKYLNKYNG------SYIPPGWREWGGLIMNSKYYNYSINLNGQKIK 192
            .::...| |..||:|.:.|||||:|..      .::|.||..|..|..|||||||::::||:..|
Human   130 NTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARK 194

  Fly   193 HGFDYAKDYYPDLIANDSIAFLRSSKQQNQRKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHT 257
            ||.:|:.||..|::||.|:.||   ..::..:|..:.::.||||.|..:||||...|.||.....
Human   195 HGENYSVDYLTDVLANVSLDFL---DYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRN 256

  Fly   258 PSYD-HAPNPDKQWILRVTE-PMQPVHKRFTNLLMTKRLQTLQSVDVAVERVYNELKELGELDNT 320
            .::: |..|  |.|::|..: ||.....:|.:....||.|||.|||..||::...|:..|||:||
Human   257 KNFNIHGTN--KHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNT 319

  Fly   321 YIVYTSDHGYHLGQFGLIKGKSFPFEFDVRVPFLIRGPGIQASKVVNEIVLNVDLAPTFLDMGGV 385
            ||.||||:|||.|||.|...|...:|||::||.|:|||||:.::....:|.|:||.||.||:.|.
Human   320 YIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGY 384

  Fly   386 P-TPQHMDGRSILPLLLSRNRAVRDNWPDSFLIESSG 421
            . ....|||.|:||:|...:..   .|....|:|..|
Human   385 DLNKTQMDGMSLLPILRGASNL---TWRSDVLVEYQG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 152/358 (42%)
G6S 53..408 CDD:293766 154/366 (42%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
GNSNP_002067.1 G6S 46..495 CDD:293766 158/381 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1273622at2759
OrthoFinder 1 1.000 - - FOG0001009
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.