DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and Arsb

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:NP_254278.1 Gene:Arsb / 25227 RGDID:2158 Length:528 Species:Rattus norvegicus


Alignment Length:463 Identity:107/463 - (23%)
Similarity:178/463 - (38%) Gaps:160/463 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SRDSNSARERRPNIILILTDDQD-VELGSLNFMPRT--LRLLRDGGAEFRHAYTTTPMCCPARSS 104
            :|.|::|..  |:::.:|.||.. .:||....:.||  |..|..||....: |...|:|.|:||.
  Rat    31 ARASDAAPP--PHVVFVLADDLGWNDLGFHGSVIRTPHLDALAAGGVVLDN-YYVQPLCTPSRSQ 92

  Fly   105 LLTGMY-VH----NHMVFTNNDNCSSPQWQATHETRSYATYLSNAGYRTGYFGK-YLNKYNGSYI 163
            ||||.| :|    ::::.|...||      ...:.:.....|.:|||.|...|| :|..|....:
  Rat    93 LLTGRYQIHMGLQHYLIMTCQPNC------VPLDEKLLPQLLKDAGYATHMVGKWHLGMYRKECL 151

  Fly   164 PP--GWREWGGLIMNSK-YYNYSI-----NLNGQK----IKHGFDYAKDYYPDLIANDSIAFLRS 216
            |.  |:..:.|.::.|: ||.:..     .|||.:    ::.|.:.||: |.|:.:.:......:
  Rat   152 PTRRGFDTYFGYLLGSEDYYTHEACAPIECLNGTRCALDLRDGEEPAKE-YTDIYSTNIFTKRAT 215

  Fly   217 SKQQNQ--RKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQ 279
            :...|.  .||:.|.::|.:.|.|           ..|...:...||.               :|
  Rat   216 TLIANHPPEKPLFLYLAFQSVHDP-----------LQVPEEYMEPYDF---------------IQ 254

  Fly   280 PVHKR----FTNLLMTKRLQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHLGQF----- 335
            ..|:|    ..:||           |.||..|...||..|..:||.:::::|:|   ||.     
  Rat   255 DKHRRIYAGMVSLL-----------DEAVGNVTKALKSRGLWNNTVLIFSTDNG---GQTRSGGN 305

  Fly   336 -------------GLIKGKSFPFEFDVRVPFLIRGPGIQASKVVN-------------------- 367
                         |.|:|..|     |..| |::..|:::.::::                    
  Rat   306 NWPLRGRKGTLWEGGIRGAGF-----VASP-LLKQKGVKSRELMHITDWLPTLVNLAGGSTHGTK 364

  Fly   368 --------------------EIVLNVDLAPTFLDMGGVPTPQHMDGRSILPLLLSRNRAVRDNWP 412
                                |::||:|  |.|.|  |:|.|    |::..|   .:|        
  Rat   365 PLDGFDVWETISEGSPSPRVELLLNID--PDFFD--GLPCP----GKNTTP---EKN-------- 410

  Fly   413 DSFLIESS 420
            |||.:|.|
  Rat   411 DSFPLEHS 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 97/431 (23%)
G6S 53..408 CDD:293766 99/439 (23%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
ArsbNP_254278.1 AslA 36..484 CDD:225661 105/458 (23%)
4-S 40..483 CDD:293753 104/452 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.