DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sulf1 and arsia

DIOPT Version :9

Sequence 1:NP_001262626.1 Gene:Sulf1 / 53437 FlyBaseID:FBgn0040271 Length:1114 Species:Drosophila melanogaster
Sequence 2:XP_002664306.1 Gene:arsia / 100329483 ZFINID:ZDB-GENE-140106-141 Length:558 Species:Danio rerio


Alignment Length:379 Identity:94/379 - (24%)
Similarity:151/379 - (39%) Gaps:91/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RPNIILILTDDQ---DVELGSLNFMPRTLRLLRDGGAEFRHAYTTTPMCCPARSSLLTGMY-VH- 112
            ||:||.|:||||   |:...:.:....||..|...|.:..: |...|:|.|:||..:||.| :| 
Zfish    37 RPHIIFIMTDDQGFNDIGYHNTDIHTPTLDRLAAAGVKLEN-YYIQPICTPSRSQFITGRYQIHT 100

  Fly   113 --NHMVFTNNDNCSSPQWQATHETRSYATYLSNAGYRTGYFGK-YLNKYNGSYIPP--GWREWGG 172
              .|.:..:......|     ...|:....|..|||.|...|| :|..|....:|.  |:..:.|
Zfish   101 GLQHSIIRSRQPSCLP-----FGLRTLPQRLQEAGYATHMVGKWHLGFYKRDCLPTRRGFNTYFG 160

  Fly   173 LIMNS-KYYNYSINLNGQKIKHGFD--------------YAKDYYPDLIANDSIAFLRSSKQQNQ 222
            .:..| .||.|. :.:|.|: .|||              |:...|...:.....|...||     
Zfish   161 SLTGSVDYYTYK-SCDGPKV-CGFDLHDGERVAWGQGGRYSTHLYTQRVRKILAAHDPSS----- 218

  Fly   223 RKPVLLTMSFPAPHGPEDSAPQYSHLFFNVTTHHTPSYDHAPNPDKQWILRVTEPMQPVHKRFTN 287
             :|:.:.:||.|.|.|..|..:|.:                                 .::|..|
Zfish   219 -QPLFIFLSFQAVHTPLQSPKEYVY---------------------------------PYRRMGN 249

  Fly   288 LLMTKRLQTLQSVDVAVERVYNELKELGELDNTYIVYTSDHGYHLGQ--FGLIKGKSFP------ 344
            :...|....:.:||.||..|...|::.|...||.|.:::|:|   ||  ||   |.::|      
Zfish   250 MFRRKYAGMVSAVDEAVRNVTYALRKYGYYKNTVIFFSTDNG---GQPLFG---GSNWPLRGRKG 308

  Fly   345 --FEFDVRVPFLIRGPGIQASKVVNEIVLNV-DLAPTFLDM--GGVPTPQHMDG 393
              :|..||....:..|.::..:.|:..:::: |..||.:.:  |.|...:.:||
Zfish   309 TYWEGGVRGIGFVHSPLLRRRRRVSRALIHITDWYPTLMRLAGGNVSQAEGLDG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sulf1NP_001262626.1 AslA 51..>398 CDD:225661 94/379 (25%)
G6S 53..408 CDD:293766 94/379 (25%)
DUF3740 640..790 CDD:289325
ALP_like <940..989 CDD:304875
arsiaXP_002664306.1 AslA 37..471 CDD:225661 94/379 (25%)
4-S 38..470 CDD:293753 93/378 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592866
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.