DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c11.1 and Mro

DIOPT Version :9

Sequence 1:NP_001285050.1 Gene:c11.1 / 53436 FlyBaseID:FBgn0040236 Length:1742 Species:Drosophila melanogaster
Sequence 2:NP_001347902.1 Gene:Mro / 71263 MGIID:2152817 Length:383 Species:Mus musculus


Alignment Length:198 Identity:49/198 - (24%)
Similarity:96/198 - (48%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1453 ELAASILLHLGAALSDPNAVVRGLSIQGMGYVG-QLGEKEAKRYSETAIGALLKGVDDPVGDCLI 1516
            ||..:.|..|.....||||..|.|:::|:|.:. :..:|:.::|.:..:..|::|:.|||...:|
Mouse   178 ELLKNALFVLAERARDPNAKKRHLAMRGLGALAREAPDKQVRKYKKVMLDLLVRGLYDPVSSEVI 242

  Fly  1517 NIPLESMRGLSGILRALPSERVEPFHVSLAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSS 1581
            :   ||::.|:.:|..:....:..|.:.:.::.|..|.:....:|.:|..|||.:       .|.
Mouse   243 H---ESVKTLTIMLGKIQGHGLGSFFIDITLQARTLLDDEDDSVRYSAFVLFGQL-------ASF 297

  Fly  1582 SPTSSMEALREQLIANLFPLLLHLSESEVAIASACRGTLQRVCRLLTAPRVVEMAEQQLGEERGH 1646
            :.....:...:|:......||.||.:....:|.||:.|: |.|.....||.|...:.: .:::.|
Mouse   298 AGWRWKKFFTQQVNQTQDSLLGHLQDESPKVAKACKMTV-RACVPYLKPRKVPSFQSE-EDQKNH 360

  Fly  1647 QLN 1649
            :|:
Mouse   361 RLS 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c11.1NP_001285050.1 None
MroNP_001347902.1 HEAT repeat 183..211 CDD:293787 10/27 (37%)
HEAT repeat 224..259 CDD:293787 10/37 (27%)
HEAT repeat 268..293 CDD:293787 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2032
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D31329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.