Sequence 1: | NP_001285050.1 | Gene: | c11.1 / 53436 | FlyBaseID: | FBgn0040236 | Length: | 1742 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001347902.1 | Gene: | Mro / 71263 | MGIID: | 2152817 | Length: | 383 | Species: | Mus musculus |
Alignment Length: | 198 | Identity: | 49/198 - (24%) |
---|---|---|---|
Similarity: | 96/198 - (48%) | Gaps: | 13/198 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 1453 ELAASILLHLGAALSDPNAVVRGLSIQGMGYVG-QLGEKEAKRYSETAIGALLKGVDDPVGDCLI 1516
Fly 1517 NIPLESMRGLSGILRALPSERVEPFHVSLAIRIRPFLGNYALEMREAAIQLFGDICEGKHDDGSS 1581
Fly 1582 SPTSSMEALREQLIANLFPLLLHLSESEVAIASACRGTLQRVCRLLTAPRVVEMAEQQLGEERGH 1646
Fly 1647 QLN 1649 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
c11.1 | NP_001285050.1 | None | |||
Mro | NP_001347902.1 | HEAT repeat | 183..211 | CDD:293787 | 10/27 (37%) |
HEAT repeat | 224..259 | CDD:293787 | 10/37 (27%) | ||
HEAT repeat | 268..293 | CDD:293787 | 6/24 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2032 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D31329at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |