DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and EMB2769

DIOPT Version :9

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_566447.1 Gene:EMB2769 / 820510 AraportID:AT3G13200 Length:230 Species:Arabidopsis thaliana


Alignment Length:260 Identity:103/260 - (39%)
Similarity:145/260 - (55%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEE 65
            ||||||||:.||:||:.:|...:...|::|||||:..||.||.|..||.|.:|.:..:.|.||||
plant     1 MTTAARPTWAPAKGGNEQGGARIFGPSQKYSSRDVAAHTTLKPRREGQHTQEELQKINLRDELEE 65

  Fly    66 REREARSGTGATSSSSGKALPSIVRKAIEANNAGGGSSAAKRSKPDAGQQQAQQAAQQQAANMDA 130
            |||.       ..||..|:...      :.:...|.....:.||.|..::...::.  .|.:.|.
plant    66 RERR-------HFSSKDKSYND------DRDRRRGSQLLLEDSKRDPEERIIPRSV--DADDSDV 115

  Fly   131 DEPLDNDSSD-SDSDSDDDDAALLAELQKIKQERLQETARRESEKKQEDERIRMENILSGNPLMN 194
            |...|:||.| ||.|.:||..||:|||.:||:||::|..|:|.|::.|:...:.|.:|.||||:|
plant   116 DIKSDDDSDDESDDDDEDDTEALMAELDQIKKERVEERLRKEKEQQMEELNAKEEELLKGNPLLN 180

  Fly   195 YEPGTAASAAGRASGLGGDLKIKRRWDDDVVFKNCARSAPDKKTHFVNDALRSDFHKKFMDKYIK 259
                |..|           ..:||||||||||||.||........|:||.:|:|||:||:.:|:|
plant   181 ----TPTS-----------FSVKRRWDDDVVFKNQARGEMKAPKRFINDTIRNDFHRKFLHRYMK 230

  Fly   260  259
            plant   231  230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 101/257 (39%)
EMB2769NP_566447.1 Cwf_Cwc_15 1..229 CDD:282713 101/257 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 167 1.000 Domainoid score I1196
eggNOG 1 0.900 - - E1_KOG3228
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9499
Inparanoid 1 1.050 167 1.000 Inparanoid score I1570
OMA 1 1.010 - - QHG57716
OrthoDB 1 1.010 - - D1576404at2759
OrthoFinder 1 1.000 - - FOG0004833
OrthoInspector 1 1.000 - - oto3743
orthoMCL 1 0.900 - - OOG6_102825
Panther 1 1.100 - - LDO PTHR12718
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3414
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.930

Return to query results.
Submit another query.