DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and cwc15

DIOPT Version :9

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001072201.1 Gene:cwc15 / 779647 XenbaseID:XB-GENE-987018 Length:227 Species:Xenopus tropicalis


Alignment Length:263 Identity:147/263 - (55%)
Similarity:174/263 - (66%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTAARPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEE 65
            |||||||||:|||||.|:||.|||.|||||||||||.|||:|||:..|...:|.|:||||:||||
 Frog     1 MTTAARPTFEPARGGRGKGEADLSQLSKQYSSRDLPSHTKIKYRQATQDAPEEVRSRDFRRELEE 65

  Fly    66 REREARSGTGATSSSSGKALPSIVRKAIEANNAGGGSSAAKRSKPDAGQQQAQQAAQQQAANMDA 130
            |||.|                 :..|..:.......||.:|:.:.|          |..|||:||
 Frog    66 RERVA-----------------VREKNRDRPTREHASSVSKKPRLD----------QIPAANLDA 103

  Fly   131 DEPL-DNDS-SDSDSDSDDDDAALLAELQKIKQERLQETARRESEKKQEDERIRMENILSGNPLM 193
            |:|| |.|: .|||.|||||.|||||||:|||:||.:|.||:|.|:|.|:||||||||||||||:
 Frog   104 DDPLTDEDADDDSDEDSDDDTAALLAELEKIKKERAEEQARKELEQKAEEERIRMENILSGNPLL 168

  Fly   194 NYEPGTAASAAGRASGLGGDLKIKRRWDDDVVFKNCARSAPD--KKTHFVNDALRSDFHKKFMDK 256
            |. .|.|.|.|.        .|:||||||||||||||:...:  |...||||.|||:||||||:|
 Frog   169 NL-TGPAQSVAA--------FKVKRRWDDDVVFKNCAKGVDEMKKDKRFVNDTLRSEFHKKFMEK 224

  Fly   257 YIK 259
            |||
 Frog   225 YIK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 144/260 (55%)
cwc15NP_001072201.1 Cwf_Cwc_15 1..226 CDD:368177 144/260 (55%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..130 80/155 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I2028
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9499
Inparanoid 1 1.050 253 1.000 Inparanoid score I3118
OMA 1 1.010 - - QHG57716
OrthoDB 1 1.010 - - D1576404at2759
OrthoFinder 1 1.000 - - FOG0004833
OrthoInspector 1 1.000 - - oto102331
Panther 1 1.100 - - LDO PTHR12718
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R266
SonicParanoid 1 1.000 - - X3414
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.