DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.1 and xtr-2

DIOPT Version :9

Sequence 1:NP_652605.1 Gene:c12.1 / 53435 FlyBaseID:FBgn0040235 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_510059.2 Gene:xtr-2 / 192058 WormBaseID:WBGene00006966 Length:455 Species:Caenorhabditis elegans


Alignment Length:308 Identity:61/308 - (19%)
Similarity:103/308 - (33%) Gaps:91/308 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPTFDPARGGSGRGEKDLSALSKQYSSRDLPGHTKLKYRETGQGTSDENRNRDFRKELEEREREA 70
            :||..|:....|..|..:...|...|.|.  .|...|:              :|.:::.|.:::.
 Worm    93 KPTDSPSGLHFGPIENSVPIASNNPSKRS--KHEPFKF--------------NFPQKMMEYQKDV 141

  Fly    71 RSGTGATSSSSGKALPSIVRKAIEANNAG---GGSSAAKRSKPD--AGQQQAQQAAQQQAANMDA 130
            ::|     ||:.:...|.:.|    |.|.   |.||...|..|.  ..||:.:........::|.
 Worm   142 QNG-----SSNYEYFHSPMAK----NYASAKIGESSRVIRKSPRFLRAQQKVEDDECSSDESLDD 197

  Fly   131 DEPLDNDSSDSDSDSDDDDAALLAELQ--KIKQERLQETARRESEKKQEDERIRMENILSGNPL- 192
            .|..:.:..|||.:.|::..|:|..|:  ||......|..:.:...|.:.|.:..:|   ||.: 
 Worm   198 SETSEEEDVDSDGECDEEVQAVLDSLEKKKITDGNPIEVEQHKKMDKPQTETVENDN---GNVID 259

  Fly   193 MNYEPGTAASAAGRAS------------------------------------------------- 208
            :...|.|.....|..:                                                 
 Worm   260 VTGMPYTVLHVKGSDTDRFVMYKGSLQKIIAVQTVRHVDYQYQIYIINKNKPIDILFGEVILSST 324

  Fly   209 -GLGGDLKIKRRWDDDVVFKNCARSAPDKKTHFVND-ALRSDFHKKFM 254
             |||.|.....|   |..|.|.||:.. ::.||..| ...::|..:|:
 Worm   325 LGLGEDEATMSR---DAQFVNYARNIA-RRNHFYEDGGTLTEFDNRFL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c12.1NP_652605.1 Cwf_Cwc_15 1..258 CDD:282713 61/308 (20%)
xtr-2NP_510059.2 Upf2 185..>226 CDD:281974 9/40 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.