DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment c12.2 and stm

DIOPT Version :9

Sequence 1:NP_001259381.1 Gene:c12.2 / 53434 FlyBaseID:FBgn0040234 Length:1403 Species:Drosophila melanogaster
Sequence 2:NP_942112.2 Gene:stm / 386700 ZFINID:ZDB-GENE-031112-4 Length:613 Species:Danio rerio


Alignment Length:157 Identity:36/157 - (22%)
Similarity:53/157 - (33%) Gaps:24/157 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 PKNEPHVGGNTWAGGSGGRDTAGLGGKGGPFRLDK--GHKVHQLSD-----EEKADVPEEIKRAA 1114
            |..|.|..||     ..|:|:.  ..|..|...||  |.......|     .||.|........|
Zfish   163 PSAEDHTDGN-----HAGKDST--DSKESPDTTDKPEGPDSDSAPDGDSASAEKTDSDHSPDEDA 220

  Fly  1115 REMNRKAFEDKLKEIKMSAHDHKLYAQFSEPNRKQVQQLKAVLEAMQTKSKERQWQKYQTHGDLD 1179
            .:.:.:|.:|...:...|..|.|..:..|:.:.|...:.:...|...:|..|   .|.|...|..
Zfish   221 NKSSTEADKDDTSDKDSSQTDEKHDSDASDKDEKHEDKDEKSDEKDSSKDSE---DKSQEKSDKS 282

  Fly  1180 DTRLVEGITGEKNIYRRRAEANPWADH 1206
            |    :|...|.:..:...|:.   ||
Zfish   283 D----DGSNSEADEQKESVESK---DH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
c12.2NP_001259381.1 AAA_5 112..268 CDD:285029
AAA_5 435..595 CDD:285029
AAA_5 770..916 CDD:285029
vWA_F11C1-5a_type 1212..1403 CDD:238732
stmNP_942112.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..613 36/157 (23%)
PHA02664 <163..298 CDD:177447 33/148 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5271
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.