DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and vhl

DIOPT Version :9

Sequence 1:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001016367.1 Gene:vhl / 549121 XenbaseID:XB-GENE-493997 Length:167 Species:Xenopus tropicalis


Alignment Length:153 Identity:43/153 - (28%)
Similarity:66/153 - (43%) Gaps:24/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIF 89
            |.|:|.|.:.||:...||..:.....|.||......|:||:..|.||||:..|...:.|..:.::
 Frog    23 VQVVFCNRSTRTVQPIWVNFQGDPQSYPTLPAGSGRRMNTYLGHIWLFREAETDVGLMVNKKEVY 87

  Fly    90 QPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIRTSNAPRRIIHGYHIPSTL 154
            .|    .|.....|       :.|.|..|:.||:|.||.:| |.|::..:..:..|         
 Frog    88 VP----NPNVNGQP-------ALVNISLPVFSLKERCLQVV-RSLVKPEDYRKLEI--------- 131

  Fly   155 KQQLLSLLTCIESYSRVAGTRRR 177
               ::||...:|:...||...||
 Frog   132 ---VVSLYEDLENRPDVAKDLRR 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 37/136 (27%)
vhlNP_001016367.1 pVHL 15..152 CDD:176472 43/153 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12308
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5297
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509532at2759
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 1 1.000 - - oto103421
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9301
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.