DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and VHLL

DIOPT Version :10

Sequence 1:NP_524986.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001004319.1 Gene:VHLL / 391104 HGNCID:30666 Length:139 Species:Homo sapiens


Alignment Length:65 Identity:20/65 - (30%)
Similarity:34/65 - (52%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRIFQP 91
            ::..|.:.|.:...|:....:...||||.|..:.|::.|.:|.|||||..|.:::.|....:|.|
Human    56 IIICNHSPRIVLPVWLNYYGKLLPYLTLLPGRDFRIHNFRSHPWLFRDARTHDKLLVNQTELFVP 120

  Fly    92  91
            Human   121  120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_524986.1 pVHL 21..162 CDD:176472 20/65 (31%)
VHLLNP_001004319.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
pVHL 45..126 CDD:470794 20/65 (31%)
Beta-domain 54..135 20/65 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.