DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vhl and vhl-1

DIOPT Version :9

Sequence 1:NP_001260885.1 Gene:Vhl / 53433 FlyBaseID:FBgn0041174 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_509889.1 Gene:vhl-1 / 181321 WormBaseID:WBGene00006922 Length:174 Species:Caenorhabditis elegans


Alignment Length:150 Identity:35/150 - (23%)
Similarity:68/150 - (45%) Gaps:17/150 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EVYVLFANTTYRTLDLYWVCERERENMYLTLKPFEEVRVNTFTTHSWLFRDYYTGERMHVRSQRI 88
            |:.|.|.|.....:|::|:...::...|.||...:.:.:.||..|.|:.|..:.|.::.|..:.:
 Worm    25 EIRVRFLNRCAYPVDVFWLNPSKQPTKYGTLAQKKYLDIKTFKDHPWVARRSFDGCKVLVNEKEV 89

  Fly    89 FQPIRVRVPKSQQSPDQLVDVRSEVLIHFPMRSLRENCLWLVARWLIR--TSNAPRRIIHGYHIP 151
            |.|        :.:|...:.||:..:|...::||||    :..|..:|  .:..|.:|   ..:|
 Worm    90 FWP--------EPAPRMNLIVRNHCVITMKVQSLRE----IAGRSFLRHNPTEVPNKI---KGLP 139

  Fly   152 STLKQQLLSLLTCIESYSRV 171
            ..|:.::...|...:.||.:
 Worm   140 RELQFEVKHFLDRKQEYSEI 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
VhlNP_001260885.1 pVHL 21..162 CDD:176472 32/139 (23%)
vhl-1NP_509889.1 pVHL 19..157 CDD:176472 33/146 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4710
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I4144
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509532at2759
OrthoFinder 1 1.000 - - FOG0005700
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107013
Panther 1 1.100 - - LDO PTHR15160
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.