DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and CG42514

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_730171.1 Gene:CG42514 / 8674108 FlyBaseID:FBgn0260388 Length:533 Species:Drosophila melanogaster


Alignment Length:340 Identity:66/340 - (19%)
Similarity:123/340 - (36%) Gaps:110/340 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   564 DLGIF--CVAF-------KDKSVEWNYLHQPDYIFKYSVALGWGIGCCLIY-IQSVNNSDIFYTG 618
            |:.||  |.|:       :.:::....|   |.|:..::.:|..:|..|.| :.:.:.:|:|   
  Fly   193 DVAIFASCFAYISDISSLQQRTIRVTIL---DVIYLSAMPMGVALGSHLFYNVFNQSYADMF--- 251

  Fly   619 VVINIIAFFVLTFLLFICWYKKVCWWHSGQNEHRSYGKLSCAIF--HLFEKIQHSFVLRLTV--- 678
             .:| .:...|..:..:|..|    |.:...: ||..:|.|..|  ..|:|......|.:.|   
  Fly   252 -TVN-ASLLALAIIYTLCALK----WQTTPRQ-RSLRELGCCGFWGDFFDKQHVKDSLAVLVKPR 309

  Fly   679 ------YMMIILCYYMVISLILMSCEKD--QYELDIIESKLYNYDMDPFTCFHPW---AYTNM-- 730
                  :::|:|     :|:.|.:.::|  ||        ||.|.:..|    .|   ||:|.  
  Fly   310 KGHRRSFLIILL-----VSMALYTFQRDEGQY--------LYMYTLGKF----DWDVSAYSNFKT 357

  Fly   731 ---MALILGMSYTFARIPFALKTFIGCAEAVVFVLVVCFQYAFIFEHSVTTSPYLKAEIAHSCRV 792
               .|.::.|   ...:|...|........::|:.......|.:|.:..|.:..|.|    ...|
  Fly   358 FKSSAYVIAM---LLAVPLMNKILGWRDTTIIFIGTWAHSIARLFFYFATNTDLLYA----GAVV 415

  Fly   793 CM-------MLITMYAK-----ERQSEFNTKMNYKLNLDLQNKQKSADVTNQSIIILLNNILPSH 845
            |.       |:..|.:|     ||...|                        :::.:.:|.:|  
  Fly   416 CSLGPIVGPMIRAMTSKIVPTSERGKVF------------------------ALLSVCDNAVP-- 454

  Fly   846 VVEVYLSSIAKHELY 860
                ::|.:...:||
  Fly   455 ----FISGVCYSQLY 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485
Nucleotidyl_cyc_III 306..489 CDD:299850
CYCc 831..1055 CDD:214485 5/30 (17%)
Nucleotidyl_cyc_III 859..1080 CDD:299850 2/2 (100%)
CG42514NP_730171.1 MFS_1 129..458 CDD:284993 63/331 (19%)
MFS 132..495 CDD:119392 66/340 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4862
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.