DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Phlpp1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_038946976.1 Gene:Phlpp1 / 59265 RGDID:621308 Length:1718 Species:Rattus norvegicus


Alignment Length:372 Identity:70/372 - (18%)
Similarity:134/372 - (36%) Gaps:91/372 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IDFFHYLGFNMMGIFFRIMND---TMVRSSFLDRYQF---ITEEIWLRQARRQESLLLDSILPPQ 270
            ::..|.|.:  :|:.|....|   .:.:.:.:|:...   ..|.:.|:..||.          |.
  Rat   719 LENMHQLSY--LGLSFNEFTDIPEVLEKLTAVDKLCMAGNCMETLRLQALRRM----------PH 771

  Fly   271 IAK-PIQKSIKEKIIQPDNDF-YHLGTSRTAEN---FMSIQIHNDVSILYADLVNYTQLTTTLTV 330
            |.. .::.:|..|:|..:.|| .|:......:|   .:...|.|::.:|:.:   ..||.|....
  Rat   772 IKHVDLRLNILRKLITDEVDFLQHVTQLDLRDNKLGDLDAMIFNNIEVLHCE---RNQLVTLNIC 833

  Fly   331 EKLVKVLH---DLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMIANIK 392
            ...:|.|:   :...:.|:..:...:..:....:|.       ||.|:....:..|      .:.
  Rat   834 GYFLKALYASSNELVQLDVYPVPNYLSYMDVSRNCL-------ESVPEWVCESRKL------EVL 885

  Fly   393 EVSVNRSLNIGMRIGVHSG--TLFAGVIGKAKLQYDIWGADVNIASRLEATG------------- 442
            ::..|:...:..|:..:|.  .|.||....|:|           ..|||.|.             
  Rat   886 DIGHNQICELPARLFCNSSLRKLLAGHNRLARL-----------PERLERTSVEVLDVQHNQIIE 939

  Fly   443 SPGYVHVSGRTLSSLNAEEYNIY---PGTESAQKDPVLQKHPMSTYLLTAIPSLDSDKTISIVEG 504
            .|..:.:...:|..|||....:.   |.|.|.:...:||:..::...||       ||.:.::.|
  Rat   940 LPPNLLMKADSLRFLNASANKLETLPPATLSEETSSILQELYLTNNSLT-------DKCVPLLTG 997

  Fly   505 VPNLDLQTVGSNR-----KSQILKPNLLSHEMREEFRKMPVGGFKFQ 546
            .|.|.:..:..||     .|::.|        .||..::.:.|.|.:
  Rat   998 HPRLKILHMAYNRLQSFPASKMAK--------LEELEEIDISGNKLK 1036

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 17/86 (20%)
CYCc 262..464 CDD:214485 40/224 (18%)
Nucleotidyl_cyc_III 306..489 CDD:299850 37/203 (18%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Phlpp1XP_038946976.1 Ubiquitin_like_fold 176..>224 CDD:421700
PHA03247 <237..443 CDD:223021
RA_PHLPP1 <424..491 CDD:340760
PH_PHLPP-like 498..594 CDD:270131
PLN00113 602..>1109 CDD:215061 70/372 (19%)
leucine-rich repeat 604..624 CDD:275380
leucine-rich repeat 625..655 CDD:275380
leucine-rich repeat 679..701 CDD:275380
leucine-rich repeat 702..724 CDD:275380 0/4 (0%)
leucine-rich repeat 725..771 CDD:275380 9/57 (16%)
leucine-rich repeat 772..795 CDD:275380 6/22 (27%)
leucine-rich repeat 796..816 CDD:275380 2/19 (11%)
leucine-rich repeat 817..858 CDD:275380 7/43 (16%)
leucine-rich repeat 859..881 CDD:275380 4/28 (14%)
leucine-rich repeat 882..904 CDD:275380 3/27 (11%)
leucine-rich repeat 905..926 CDD:275380 8/31 (26%)
leucine-rich repeat 927..950 CDD:275380 1/22 (5%)
leucine-rich repeat 951..974 CDD:275380 7/22 (32%)
leucine-rich repeat 977..1000 CDD:275380 7/29 (24%)
leucine-rich repeat 1001..1024 CDD:275380 5/30 (17%)
leucine-rich repeat 1067..1112 CDD:275380
PP2Cc 1151..1403 CDD:214625
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.