DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and CG34357

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001356914.1 Gene:CG34357 / 5740349 FlyBaseID:FBgn0085386 Length:1689 Species:Drosophila melanogaster


Alignment Length:433 Identity:102/433 - (23%)
Similarity:176/433 - (40%) Gaps:144/433 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FNMMGIFFRIMN--------DTMVRSSFLDRYQFITEEIWLRQ-------ARRQESLLLDSILPP 269
            ||.:...|:::|        |||.:  .|::|....||: :|:       .|::...||:.:||.
  Fly  1028 FNSVYERFKMLNHGRKVNFVDTMFQ--MLEKYSNNLEEL-IRERTEQLDIERKKTEQLLNRMLPS 1089

  Fly   270 QIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLV 334
            .:|:.::                :|.:...|.|      :||:|.::|:|.:|.:....:..::|
  Fly  1090 SVAEKLK----------------MGLAVDPEEF------SDVTIYFSDIVGFTTIAAHCSPVQVV 1132

  Fly   335 KVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAVSLGISMI-----ANIKEV 394
            .:|:|||..||....::.|.:::.:||.|..|:||....||||....::.:.::     .|:|.:
  Fly  1133 DLLNDLYTIFDATINAYNVYKVETIGDAYMVVSGLPVKIPDHAEQIATMALDLLHQSGRFNVKHL 1197

  Fly   395 SVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNA 459
            .   .:.:.:|||:|:|...|||:|....:|.::|..||.|||:|:|||...:|:|..|...|:|
  Fly  1198 P---GVPLQLRIGLHTGPCCAGVVGLTMPRYCLFGDTVNTASRMESTGSSWRIHMSQETRDRLDA 1259

  Fly   460 E-EYNIYP------------------GTESAQK-----DPVLQKHPMSTYLL------------- 487
            . .|.|.|                  |.:...|     .|:.:.|.:...|:             
  Fly  1260 RGGYAIEPRGLIDIKGKGMMNTFWLLGKKGFDKPLPAPPPIGESHGLDESLIRNSITLKAQANKS 1324

  Fly   488 ------------------------------------TAIP---SLDSDKTISIVEGVPNLDL--- 510
                                                |.:|   ||||:.|.:|   .||..|   
  Fly  1325 RTSTNPSSSQSSSLAGESVEVKVEITPPTNADLASGTNLPNSYSLDSNSTNTI---SPNATLCPE 1386

  Fly   511 --------QTVGSNRK-SQILKPNLLSHEMREEFRKMP--VGG 542
                    .|...:|| |::...|||:   ...|.::|  .||
  Fly  1387 FPGKTTPSSTSPQSRKLSELTPENLLN---PNSFNRLPSSTGG 1426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 18/85 (21%)
CYCc 262..464 CDD:214485 60/207 (29%)
Nucleotidyl_cyc_III 306..489 CDD:299850 59/260 (23%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
CG34357NP_001356914.1 PKc_like 763..1041 CDD:354810 4/12 (33%)
CYCc 1074..1266 CDD:214485 61/216 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.