DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and npr3

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:XP_005165413.1 Gene:npr3 / 569395 ZFINID:ZDB-GENE-060531-91 Length:503 Species:Danio rerio


Alignment Length:172 Identity:34/172 - (19%)
Similarity:58/172 - (33%) Gaps:41/172 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 RTAENFMSIQIH---NDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKF 358
            :.||.|.:|..|   ....::|.|  :..:.....|:|.:..||.:.:...|.|.|:...:|:  
Zfish   150 KMAETFQAIFGHFGWRTAYLIYDD--DKDERNCYFTMEGVFTVLSEYHISTDFAVLNSNEERV-- 210

  Fly   359 LGDCYYCVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKL 423
                          |||....:| .|..::....:..:.|.|    .:..|          :.||
Zfish   211 --------------DPDGIITSV-YGSEVVIMCSKADIVRDL----MLAAH----------RRKL 246

  Fly   424 QYDIWGADVNIASRLEATGSPGYVHVSGRTLSSLNAEEYNIY 465
            .     :|.:|...:|...|..|...|.|.....:.|....|
Zfish   247 T-----SDSHIFFNIELFNSSSYGDGSWRRRDKYDDEARAAY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831
CYCc 262..464 CDD:214485 33/169 (20%)
Nucleotidyl_cyc_III 306..489 CDD:299850 30/163 (18%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
npr3XP_005165413.1 Periplasmic_Binding_Protein_Type_1 29..416 CDD:299141 34/172 (20%)
ANF_receptor 46..389 CDD:279440 34/172 (20%)
TM_EphA1 436..468 CDD:214014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.