DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and gucy1a1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_001296458.1 Gene:gucy1a1 / 550420 ZFINID:ZDB-GENE-050417-230 Length:679 Species:Danio rerio


Alignment Length:224 Identity:61/224 - (27%)
Similarity:108/224 - (48%) Gaps:35/224 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LRQARRQESLLLDSILPPQIAK------PIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHND 310
            |.:.:|:...||.:|.|..:|:      |:|                      |:.|      :.
Zfish   447 LEEEKRRTVELLFTIFPGNVAQRLWQGLPVQ----------------------AKKF------DH 483

  Fly   311 VSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPD 375
            |::|::|:|.:|.:.:..|..::|.:|.:||.|||.......|.:::.:||.|....||.:..|.
Zfish   484 VTVLFSDIVGFTAICSRCTPMQVVNMLSELYTRFDHHCGELDVYKVETIGDAYCVAGGLHKESPT 548

  Fly   376 HATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEA 440
            ||.....:.:.|:....||:......|.||||:|||::.|||:|....:|.::|.:|.:|::.|:
Zfish   549 HAVQIALMALKMMELSDEVTTPMGEVIRMRIGIHSGSVLAGVVGVKMPRYCLFGNNVTLANKFES 613

  Fly   441 TGSPGYVHVSGRTLSSL-NAEEYNIYPGT 468
            ...|..::||..|...| :..|:.:.|.|
Zfish   614 CSLPRKINVSPTTYRLLKDCPEFTLIPRT 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 9/44 (20%)
CYCc 262..464 CDD:214485 57/208 (27%)
Nucleotidyl_cyc_III 306..489 CDD:299850 50/164 (30%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
gucy1a1NP_001296458.1 HNOBA 279..470 CDD:285003 7/22 (32%)
CYCc 449..635 CDD:214485 57/213 (27%)
Guanylate_cyc 476..647 CDD:278633 53/195 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.