Sequence 1: | NP_620475.2 | Gene: | ACXA / 53432 | FlyBaseID: | FBgn0040510 | Length: | 1112 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_058786.2 | Gene: | Gucy1a1 / 497757 | RGDID: | 68436 | Length: | 690 | Species: | Rattus norvegicus |
Alignment Length: | 202 | Identity: | 56/202 - (27%) |
---|---|---|---|
Similarity: | 104/202 - (51%) | Gaps: | 22/202 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 252 LRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYA 316
Fly 317 DLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAV 381
Fly 382 SLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGY 446
Fly 447 VHVSGRT 453 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ACXA | NP_620475.2 | AC_N | <42..291 | CDD:292831 | 9/38 (24%) |
CYCc | 262..464 | CDD:214485 | 55/192 (29%) | ||
Nucleotidyl_cyc_III | 306..489 | CDD:299850 | 45/148 (30%) | ||
CYCc | 831..1055 | CDD:214485 | |||
Nucleotidyl_cyc_III | 859..1080 | CDD:299850 | |||
Gucy1a1 | NP_058786.2 | HNOB | <111..234 | CDD:285002 | |
HNOBA | 276..465 | CDD:285003 | 7/22 (32%) | ||
CYCc | 444..633 | CDD:214485 | 55/200 (28%) | ||
Guanylate_cyc | 471..642 | CDD:278633 | 48/170 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |