DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Gucy1a1

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_058786.2 Gene:Gucy1a1 / 497757 RGDID:68436 Length:690 Species:Rattus norvegicus


Alignment Length:202 Identity:56/202 - (27%)
Similarity:104/202 - (51%) Gaps:22/202 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYA 316
            |.:.:::...||.||.|.::|:.:.:.   :|:|             |:.|      |:|::|::
  Rat   442 LEEEKKKTVDLLCSIFPSEVAQQLWQG---QIVQ-------------AKKF------NEVTMLFS 484

  Fly   317 DLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYYCVAGLGESDPDHATMAV 381
            |:|.:|.:.:..:..:::.:|:.||.|||.......|.:::.:||.|....||......||....
  Rat   485 DIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHRESDTHAVQIA 549

  Fly   382 SLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLEATGSPGY 446
            .:.:.|:....||.......|.||||:|||::||||:|....:|.::|.:|.:|::.|:...|..
  Rat   550 LMALKMMELSNEVMSPHGEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRK 614

  Fly   447 VHVSGRT 453
            ::||..|
  Rat   615 INVSPTT 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 9/38 (24%)
CYCc 262..464 CDD:214485 55/192 (29%)
Nucleotidyl_cyc_III 306..489 CDD:299850 45/148 (30%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Gucy1a1NP_058786.2 HNOB <111..234 CDD:285002
HNOBA 276..465 CDD:285003 7/22 (32%)
CYCc 444..633 CDD:214485 55/200 (28%)
Guanylate_cyc 471..642 CDD:278633 48/170 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.