DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Gycbeta100B

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_524603.2 Gene:Gycbeta100B / 43682 FlyBaseID:FBgn0013973 Length:787 Species:Drosophila melanogaster


Alignment Length:294 Identity:76/294 - (25%)
Similarity:131/294 - (44%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 LRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTAENFMSIQIHNDVSILYA 316
            |...:::...||.|:||..:|..::   .::.:.|..                   ::.|:::::
  Fly   493 LESEKQKTDRLLYSVLPKSVANELR---HQRPVPPKR-------------------YDSVTLMFS 535

  Fly   317 DLVNYTQLTTTLT----VEKLVKVLHDLYARFDL---AALSFKVQRIKFLGDCYYCVAGLGESDP 374
            .:|.:.|.....|    ..|:||:|::||..||.   :..:..|.:::.:||.|..|:||.:...
  Fly   536 GIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCE 600

  Fly   375 DHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWGADVNIASRLE 439
            |||.....:.:.|:...|.|.:. |..:.:.||:|||.:..||||....:|.::|..||:.||.|
  Fly   601 DHAKCMARVALDMMDMAKNVKMG-SNPVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTE 664

  Fly   440 ATGSPGYVHVSGRT----LSSLNAE-----EYNIYPGTESAQKDPVLQK---HPMSTYLLTAIPS 492
            .||.||.::||..|    ..::|.:     ||          :.||:.|   .||..:.||.   
  Fly   665 TTGVPGRINVSEETYRLLCMAINQDDSFHLEY----------RGPVIMKGKPTPMDCWFLTR--- 716

  Fly   493 LDSDKTISIVEGVPNLDLQTVGSNRK--SQILKP 524
                .|.||:.|..:......|.|..  |.:|:|
  Fly   717 ----ATSSILGGTSSTGGSGGGGNGSLDSPLLQP 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 8/38 (21%)
CYCc 262..464 CDD:214485 59/217 (27%)
Nucleotidyl_cyc_III 306..489 CDD:299850 58/201 (29%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Gycbeta100BNP_524603.2 HNOB 2..164 CDD:285002
HNOBA 326..516 CDD:285003 7/22 (32%)
CYCc 496..688 CDD:214485 56/214 (26%)
Guanylate_cyc 522..714 CDD:278633 58/221 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.