DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ACXA and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_620475.2 Gene:ACXA / 53432 FlyBaseID:FBgn0040510 Length:1112 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:291 Identity:79/291 - (27%)
Similarity:140/291 - (48%) Gaps:49/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 VRSSFLDRYQFITEEIWLRQARRQESLLLDSILPPQIAKPIQKSIKEKIIQPDNDFYHLGTSRTA 299
            :::|..:....:|:|      |::...||..|.|.:||        ||:        .||:|..|
  Fly   417 IKNSIEEANSAVTKE------RKKNVSLLHLIFPAEIA--------EKL--------WLGSSIDA 459

  Fly   300 ENFMSIQIHNDVSILYADLVNYTQLTTTLTVEKLVKVLHDLYARFDLAALSFKVQRIKFLGDCYY 364
            :.:      .||:||::|:|.:|.:.:..|...::.:|..||..||.....|.|.:::.:||.|.
  Fly   460 KTY------PDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYC 518

  Fly   365 CVAGLGESDPDHATMAVSLGISMIANIKEVSVNRSLNIGMRIGVHSGTLFAGVIGKAKLQYDIWG 429
            ..:||..:....|.....:.:.||....:...:....|.||||:|:||:.|||:|:...:|.::|
  Fly   519 VASGLHRASIYDAHKVAWMALKMIDACSKHITHDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFG 583

  Fly   430 ADVNIASRLEATGSPGYVHVSGRT---LSSLNAEEYNIYPGTESAQKDP-VLQK---HPMST--- 484
            ..|.||::.|:......::||..|   |:.....|:.:.|      :|| .|.|   :|..|   
  Fly   584 HSVTIANKFESGSEALKINVSPTTKDWLTKHEGFEFELQP------RDPSFLPKEFPNPGGTETC 642

  Fly   485 YLLTAI--PSLDSDKTISIVEGVPNLDLQTV 513
            |.|.:.  |:|||:  :.:||.: |:.::|:
  Fly   643 YFLESFRNPALDSE--LPLVEHI-NVSMKTI 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ACXANP_620475.2 AC_N <42..291 CDD:292831 12/55 (22%)
CYCc 262..464 CDD:214485 58/204 (28%)
Nucleotidyl_cyc_III 306..489 CDD:299850 55/192 (29%)
CYCc 831..1055 CDD:214485
Nucleotidyl_cyc_III 859..1080 CDD:299850
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 11/47 (23%)
CYCc 430..619 CDD:214485 59/216 (27%)
Guanylate_cyc 457..647 CDD:278633 56/201 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453981
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.